KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_3332
Entry
SPC_3332          CDS       T00862                                 

Gene name
gadD
Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00052  Galactose metabolism
sei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPC_3332 (gadD)
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     SPC_3332 (gadD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 MTS ADH_zinc_N_2 2-Hacid_dh_C TrkA_N Methyltransf_31 Methyltransf_11 3HCDH_N Shikimate_DH PrmA UDPG_MGDP_dh_N Met_10 Pyr_redox_2 Sacchrp_dh_NADP Methyltransf_24 CoA_binding ELFV_dehydrog Pyr_redox FAD_binding_2 Fer4_4
Other DBs
NCBI-ProteinID: ACN47417
UniProt: C0PZ29
LinkDB
Position
3364698..3365708
AA seq 336 aa
MRVEERPLPQLQAENDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHEFSGYVESYGTG
VTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEYVVVKRANLFRL
PSDMPIEDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCARELGARSVTAI
DINPQKLELAKALGATHTCNSREMTADDIQTALSDIQFDQLVLETAGTPQTVSLAIDIAG
PRAQLALVGTLHHDLTLTTRTFGLILRKELTLLGSWMNYSAPWPGEEWETAARLLAEKRL
QLTPLIAHRGDAESFAEAVKALNGAPMQGKILLQLS
NT seq 1011 nt   +upstreamnt  +downstreamnt
gtgcgcgttgaagaacgtcccttaccacaactgcaagccgagaacgatgtgttggtcaag
gtcgttagctcagggctttgcgggtcggatatcccgcgtattttcgcgcagggcgcccat
tattatcctattacgttaggccatgaattcagcggctacgttgaatcctacggcacaggc
gtaacggatatgcagcccggcgatgccgtcgcttgtgtcccgcttcttccctgctttcac
tgtccgcaatgcgaacgcggttacttttctttatgcaaacagtatcagtttgtaggatcg
cgcagcgaaggcggtaatgcggaatatgtggtggtcaaacgggccaatcttttccgcttg
ccgtctgatatgccgattgaagatggcgcgtttatcgaaccgattaccgtgggcttacac
gcctttcatctggcgcagggctgcgaggggaaaaacgtaattatcgtcggggccgggaca
attggcctgctggccttacagtgcgcgcgggaactgggcgcgcgaagcgtaacggcgatt
gatatcaatccgcagaaactggaactggcgaaagcgctcggcgcaacgcatacctgtaat
agccgggaaatgaccgccgacgacatccagaccgcgttgtccgacattcagtttgatcaa
ctggttctcgaaacggcaggaactccccagaccgtctcgctggctatcgatatcgccggg
ccgcgagcgcaactggcgctggtggggacgttacatcacgatctcaccctgacgacgcgc
acattcgggttaattttgcgtaaagagctcacgctcctcggcagttggatgaactactcc
gcgccatggccaggagaagaatgggaaaccgcagcgcgcctgttagctgaaaaacgtctt
caactgacccctctcattgcccaccgcggcgatgcggaaagctttgcagaagcagtcaaa
gcgcttaatggcgcgcccatgcagggcaaaatcttacttcaactttcctga

DBGET integrated database retrieval system