KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_3669Help
Entry
SPC_3669          CDS       T00862                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00040  Pentose and glucuronate interconversions
sei00051  Fructose and mannose metabolism
sei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPC_3669
   00051 Fructose and mannose metabolism
    SPC_3669
Enzymes [BR:sei01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SPC_3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACN47750
UniProt: C0Q154
LinkDB All DBs
Position
complement(3703953..3704960)
Genome map
AA seq 335 aa AA seqDB search
MLIIFLIKAPVIHNKVTIMKFSSRINSFRSRPELFNADNKMDTCDLITRMGNVDGLTHIE
LNYPEHFIGQDKKIIKQCITDNGLKVSGIALRYNKDFIDGEFTNPDSVLRDKAIETTLEA
AEVCKFLGGTTVTLWFGYDGYDYPFQQDYFRAYELLVNALRKVTSAHPDLQFSFEYKPYE
PRTFSYISDVSSTLMLIDDVGNDNLGITLDFCHMIMKKENPAFSLFQSARKNRLVGFHLN
DGYGHFDDGLMLGSVHLLQTLEYIYYAKRVNFNGLIYFDTFPSREDPVAECALNIRMYKA
LSDFIDQLSIPEIEAMIKSQDALKVQGMLLSMIAK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgctcataatctttcttataaaagcacctgtgatacataacaaggtgactataatgaaa
ttttcttcgcgaattaattctttccgctcaagacctgaattatttaatgcagataataag
atggatacatgtgatcttattacaagaatgggcaatgtagatggattgacgcatatagag
ctaaactatcctgagcattttattggacaggataaaaaaatcattaaacaatgtattaca
gataacggattgaaagttagcggcattgcactacgttacaataaagattttattgatggt
gaatttactaacccagattcggttcttcgcgataaagcgattgagacaacgttggaagct
gctgaagtttgtaagttcctggggggcactactgtaacattatggtttggctatgacggt
tatgattacccatttcaacaagactattttcgagcgtatgaattgctggtaaatgcctta
cgtaaggtgacaagtgctcatccagatcttcagtttagttttgaatacaagccttatgaa
ccacggaccttttcttatattagtgatgtttcctcaaccctaatgttaattgatgatgtc
ggtaacgataacttggggattacacttgatttctgccatatgataatgaaaaaggaaaac
ccagcattttcattattccagtcagcacgtaaaaatagacttgtaggcttccatttaaat
gatggatatggtcatttcgatgatggtttaatgttaggttcagtccatctgttacagact
cttgaatatatttactatgctaaacgcgttaatttcaatggattgatttattttgatact
ttccctagccgcgaggatccagttgcagaatgtgcgctgaatattcgaatgtataaagca
ctttcagactttatagatcaactcagtattcctgagatagaagcgatgatcaaaagccag
gatgcactaaaagtacagggtatgttgttaagcatgatagccaaataa

DBGET integrated database retrieval system