KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_0777Help
Entry
STMUK_0777        CDS       T01743                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej00010  Glycolysis / Gluconeogenesis
sej00260  Glycine, serine and threonine metabolism
sej00680  Methane metabolism
sej01100  Metabolic pathways
sej01110  Biosynthesis of secondary metabolites
sej01120  Microbial metabolism in diverse environments
sej01130  Biosynthesis of antibiotics
sej01200  Carbon metabolism
sej01230  Biosynthesis of amino acids
Module
sej_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sej_M00002  Glycolysis, core module involving three-carbon compounds
sej_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STMUK_0777 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    STMUK_0777 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STMUK_0777 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sej04131]
    STMUK_0777 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sej04147]
    STMUK_0777 (gpmA)
Enzymes [BR:sej01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     STMUK_0777 (gpmA)
Membrane trafficking [BR:sej04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    STMUK_0777 (gpmA)
Exosome [BR:sej04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   STMUK_0777 (gpmA)
  Exosomal proteins of melanoma cells
   STMUK_0777 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEF06686
LinkDB All DBs
Position
complement(836703..837455)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system