KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_0869Help
Entry
STMUK_0869        CDS       T01743                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase fraction C
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej00550  Peptidoglycan biosynthesis
sej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sej00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STMUK_0869 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sej01002]
    STMUK_0869 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sej01011]
    STMUK_0869 (dacC)
Enzymes [BR:sej01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STMUK_0869 (dacC)
Peptidases [BR:sej01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   STMUK_0869 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:sej01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   STMUK_0869 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase CD52
Motif
Other DBs
NCBI-ProteinID: AEF06778
LinkDB All DBs
Position
935838..937040
Genome map
AA seq 400 aa AA seqDB search
MTQYASSLRSLAAGSVLLFLFASPVKAEEQTIAPPGVDARAWILMDYASGKVLAEGNADE
KLDPASLTKIMTSYVVGQALKAGKIKLTDMVTVGKDAWATGNPALRGSSVMFLKPGDQVS
VADLNKGIIIQSGNDACIALADYVAGSQESFIGLMNAYAKRLGLTNTTFQTVHGLDAPGQ
FSTARDMALLGKALIHDVPDEYAIHKEKEFTFNNIRQPNRNRLLWSTNLHVDGMKTGTTA
GAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQ
RVWFGDKHEVNLGAGDAGSVTIPRGQLKNLKASFTLNEPQLTAPLKKGQVVGTIDFQLNG
KSIEQRPLMVMENVEEGGFFSRMWDFVLMKLHQWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatacgcttcttcccttcgtagcctcgcggcaggttcggttctcttattcctt
ttcgcttcgcctgtaaaggcagaggaacaaacgatcgcgccgccgggcgttgatgcgcga
gcctggatcttaatggattacgccagcggtaaagtactggcggaaggcaacgccgatgag
aaactcgaccctgccagtttgacaaaaattatgaccagctacgtggtgggccaggcgctg
aaggcagggaaaatcaagctgaccgatatggtgacggtgggcaaagatgcctgggcgacg
gggaacccggcgctacgtgggtcgtcggtgatgtttctgaagccaggcgatcaggtgtcg
gttgcggatcttaataaaggcatcatcattcagtcaggtaacgatgcctgtatcgcgctt
gccgactacgtcgccggaagccaggagtcctttatcggcctgatgaacgcctatgcgaaa
cgactggggttaaccaatacaaccttccagacggtacacggtcttgatgcgccagggcag
ttcagtaccgctcgcgatatggcgttgctcggcaaggccttgattcacgatgtgcctgac
gaatacgccattcataaagaaaaagaatttacttttaataatattcgtcagccaaaccgc
aaccgcctgttgtggagcaccaatctgcatgtcgacggcatgaaaacggggacaacggct
ggcgctgggtataaccttgtcgcctccgccacccagggcgatatgcgcctgatctctgtc
gtgctgggggcgaaaacggaccgtattcgttttaatgagtcagaaaaactgctgacctgg
ggtttccgcttctttgaaacggtcacgccgattaaacctgacgcgacattcgtgacgcag
cgggtctggtttggcgataagcatgaggtcaatttgggggcgggcgatgcggggtctgtg
acgattccgcgtgggcagcttaaaaacctgaaggccagctttacgttgaacgaaccacag
ctcacggcgccgttgaagaaagggcaggttgtcggcaccatcgatttccagcttaacgga
aaatccattgagcaacgcccgttaatggtgatggaaaacgtcgaggaggggggatttttc
agccggatgtgggattttgtgctgatgaaactccatcagtggtttggcagttggttctcg
taa

DBGET integrated database retrieval system