KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_2616
Entry
STMUK_2616        CDS       T01743                                 

Gene name
gogB
Definition
(GenBank) leucine-rich repeat-containing protein
  KO
K23942  Gifsy-1 prophage leucine-rich repeat protein
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sej00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    STMUK_2616 (gogB)
SSDB
Motif
Pfam: FNIP LRR_4
Other DBs
NCBI-ProteinID: AEF08494
UniProt: A0A3Z2F8V9
LinkDB
Position
2728740..2730233
AA seq 497 aa
MTYRLKKRMKIGFQPAILQYAYTSNEATSNLELLNKWRIESPDIEKEERNSIYDKIIEAN
HTGSLSITAHHVTSIPVFPDNLSELNLSSCYTLESIPNLPDGLKSLTISGNQTIKISYFP
DSLESLSIDMQAYEENYTFPALPYGLKSFTACYGKFLPPLPPHLSSLSLQNFSEILCAEL
PYKLDKLDLQNCPFLPLMKMLPEELKELSIELIRTVPGTVIDDILPDKLKKLSINFCDNI
KLPVKLPVNLKSINLSSRTPIAWEIPTCNLPAHIDISTDGYVKLNPEFLTRSDITFSNKP
AGDVLSFQPGDVVYGLCKARDRVNTLVNSLYYFSKKDIIIQNTLTDAVWDRKNRAVFNKD
EKIAERLNDVQRGIFFREFLSQHKKYNITEDKYSDLSNEECWIKTSKAGLEFQTRLRERS
VIFVIDNLVDAISDIANKTGKHGNSITAHELRWVYRNRHDDLVKQNVKFFLNGEAISHED
VFSLVGWDKYKPKNRNR
NT seq 1494 nt   +upstreamnt  +downstreamnt
ttgacatatagattgaaaaagcgcatgaaaataggattccaaccagccatattgcaatat
gcatatacaagtaacgaggcgacatcaaaccttgagttattaaataaatggagaatagaa
tccccagatattgagaaggaggagcgtaatagtatttacgacaaaataatagaagcaaat
cataccgggagcttatcaattactgctcatcatgttacctctattccggtatttcctgat
aatttatccgaattgaatttatcttcatgctatacactggagtctattccaaatcttcct
gatgggttaaaaagtttaactatatctggaaatcagaccattaaaatttcatatttccca
gatagcttagagtcactatctatagatatgcaggcatatgaagaaaattatactttcccc
gcattaccttatggattaaagagttttactgcatgctatggtaaatttttgcctcccctt
cctccgcatctatcttctttgtcattgcaaaatttctctgaaatattatgtgctgagtta
ccatataaattagataaattagatttacaaaattgccctttcttgccattaatgaaaatg
ttacctgaggagttaaaagaactaagtattgaacttatacgaacagttcccggtactgtt
atagatgatattttgcctgataagctaaaaaaattaagtatcaacttttgtgataatatt
aaacttccagttaagcttcctgttaatttaaagtctatcaatttatcctcaaggacccct
attgcatgggaaataccaacctgcaatctgcctgcacatatagatattagtaccgatggt
tatgttaagcttaatcctgaatttcttaccaggagtgatattacctttagtaacaaacct
gcaggagatgtgttaagttttcagcctggagatgtggtttatggtttatgtaaggcaaga
gatcgagtaaatactttagttaattcgttatattatttttcaaaaaaagatattattatt
caaaatacattaacagatgcggtctgggacaggaagaatagagccgtgtttaataaagat
gagaagatagcagaaagattgaatgatgttcagagagggattttttttagagaattttta
tctcaacataaaaaatacaatattaccgaagataaatattcagacttatccaatgaggag
tgctggataaaaacaagtaaagccggtcttgaatttcaaacacgattgagggaacggtca
gttatttttgtcattgacaatttagttgatgctataagtgatatcgcaaataaaacagga
aagcatggtaattctattacagcacatgagctaagatgggtatatcggaatcgacatgat
gatctggtaaaacaaaatgttaaattttttcttaatggtgaggctatttcacacgaagat
gttttttcattagttggttgggataaatataagcctaaaaatagaaatcgttga

DBGET integrated database retrieval system