KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0128Help
Entry
SSPA0128          CDS       T00756                                 

Definition
(GenBank) D-alanine:D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00473  D-Alanine metabolism
sek00550  Peptidoglycan biosynthesis
sek01100  Metabolic pathways
sek01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sek00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSPA0128
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSPA0128
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SSPA0128
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sek01011]
    SSPA0128
Enzymes [BR:sek01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SSPA0128
Peptidoglycan biosynthesis and degradation proteins [BR:sek01011]
 Precursor biosynthesis
  Amino acid ligase
   SSPA0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_YheCD TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CAR58239
UniProt: B5BLC4
LinkDB All DBs
Position
154155..155075
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFI
ALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRA
EFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENALQGALSLAFQHDDEILIE
KWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQYFCPAGLEASQEAALQSL
VLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaatcgcggtcctgttgggcggaacctctgcggagcgggacgtttcgtta
aattccggcgcggcagtgttggccgggttacgtgaaggcggcattgatgcgcatcccgtc
gatccgcaagaggtcgatgtcgcgcagcttaaagcaatgggctttcagaaggtctttatt
gcgttgcatggccgcggcggtgaagatggcaccttacagggaatgcttgaactgctcggc
ctgccttataccggcagcggcgtgatggcctcggcgctttccatggataaactgcgcagt
aaattgctgtggcagggcgcaggcttaccggttgcgccgtgggtcgcgctgacgcgcgct
gagtttgaaaaaggccttagcgaagaacaaaaagcgcgaatttcggcgctgggtttaccg
ctgatcgtcaaacccagccgtgaaggctccagcgtcggtatgacgaaagtagtagaagaa
aatgctttacagggtgcgttatcattggcttttcagcatgatgacgaaatactgattgag
aaatggctgtgcggtccggaatttacggtggcgatagttggcgaagaaattttaccgtca
attcgtatccaaccggcaggaaccttctatgattatgaggcgaagtatctctctgatgag
actcagtatttctgccctgccggtttagaagcgtcccaggaagccgcgctacagtctctc
gtcctgcaggcatggaaagctttaggctgcacgggatgggggcgtattgatgtcatgctg
gacagcgatggtcagttttatctgctggaagccaatacttctccggggatgaccagccat
agtctggtgccgatggcggcgcgtcaggcgggaatgagcttctcgcagttagtggtacga
attctggagttggcggactga

DBGET integrated database retrieval system