KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA3159Help
Entry
SSPA3159          CDS       T00756                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00564  Glycerophospholipid metabolism
sek01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sek00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SSPA3159
Enzymes [BR:sek01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SSPA3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 3HCDH_N Pyr_redox_2 FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: CAR61414
LinkDB All DBs
Position
3483363..3484871
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGVRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATAARRENG
LWIVEAEDIDTGKKYVWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
NQKQAYILQNEDKRIVFVIPWMEEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
QKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLASYYPGIGPAWTKTCVLPGGDIDGSREDYAAKLRRRYPFLMESLARHYSRT
YGSNTEWILGEATSLLDLGEDFGHEFYEAELKYLVDHEWVRRTEDAIWRRTKEGMWLTAE
QQSRITQWLAAYVEKHQLSMAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgatcgtgataggcgggggcattaacggtgcaggcatcgcggct
gatgccgccggacgcggtttgtccgtactcatgctggaagcgcaggatttggcctgcgca
acctcttccgccagttcgaaacttatccacggcggcttacgctaccttgaacactacgag
ttccgtctggtcagcgaagcgctggccgaacgtgaagtgctgttgaaaatggcgccgcac
atcgccttcccgatgcgttttcgtctgccgcaccgcccgcacttacgtccggcctggatg
atccgtatcggtctgtttatgtacgatcacctcggcaaacgtaccagtttacccggttcc
accggtgtgcggtttggcgcagattcggtactcaaacctgaaatcgtgcgcggattcgaa
tactccgactgctgggtagacgatgcgcgtctggtactggccaacgcacagatggtggtg
cgtaaaggcggcgaagtccttacccgtactcgcgcaaccgccgctcgtcgggaaaatggc
ctgtggattgtcgaagcggaagatatcgacaccggtaaaaaatatgtctggcaggcgcgc
ggactggttaacgccaccggcccgtgggtcaaacagttcttcgacgaagggatgcacctg
ccgtcgccgtatggcatccgcctgatcaaaggcagccatatcgtcgtgccgcgcgtccat
aatcagaaacaggcgtatattctgcaaaacgaagataagcgtatcgtctttgtcattccg
tggatggaagagttttcgatcattggcacaaccgatgtcgaatataaaggcgatccgaaa
gcggtaaaaattgaagagagcgaaattaattacctgttgaaggtctataacgcgcacttc
cagaaacaactggggcgcgatgacatcgtctggacgtactccggtgtccgtccgctgtgc
gatgatgagtccgactcgccgcaggcgatcactcgcgattatacccttgatattcatgat
gaaaacggcaaagcgccgctgctttccgtgtttggcggtaagctcacgacctaccgtaag
ctggctgaacacgcgatggaaaaactggcgtcttattatccaggcatcgggccggcatgg
accaaaacgtgcgtactgcccggcggcgacatcgacggcagccgcgaagattacgcggcg
aagctgcgtcgtcgttatccgttcctgatggaatcgctggcgcgccactattcgcgcact
tacggcagcaacacggagtggattctcggcgaagccacgtcgctgcttgatttaggcgaa
gatttcggtcatgagttttacgaggcggaactcaagtacctggtggatcacgaatgggtg
cgccgtactgaagacgctatctggcgtcgcaccaaagaaggcatgtggctgaccgccgaa
cagcagtcccgcatcacccagtggctggcggcgtatgttgagaaacaccaactttcaatg
gcgtcctga

DBGET integrated database retrieval system