KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA3560Help
Entry
SSPA3560          CDS       T00756                                 

Definition
(GenBank) large (alpha) subunit of the fatty acid-oxidizing multienzyme complex
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00071  Fatty acid degradation
sek00280  Valine, leucine and isoleucine degradation
sek00281  Geraniol degradation
sek00310  Lysine degradation
sek00362  Benzoate degradation
sek00380  Tryptophan metabolism
sek00410  beta-Alanine metabolism
sek00640  Propanoate metabolism
sek00650  Butanoate metabolism
sek00903  Limonene and pinene degradation
sek00930  Caprolactam degradation
sek01100  Metabolic pathways
sek01110  Biosynthesis of secondary metabolites
sek01120  Microbial metabolism in diverse environments
sek01130  Biosynthesis of antibiotics
sek01200  Carbon metabolism
sek01212  Fatty acid metabolism
Module
sek_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SSPA3560
   00650 Butanoate metabolism
    SSPA3560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSPA3560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSPA3560
   00310 Lysine degradation
    SSPA3560
   00380 Tryptophan metabolism
    SSPA3560
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SSPA3560
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SSPA3560
   00281 Geraniol degradation
    SSPA3560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSPA3560
   00930 Caprolactam degradation
    SSPA3560
Enzymes [BR:sek01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SSPA3560
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SSPA3560
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SSPA3560
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     SSPA3560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CAR61840
UniProt: B5BIZ0
LinkDB All DBs
Position
complement(3963234..3965411)
Genome map
AA seq 725 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALK
IGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDIETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
ETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVIAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDDLLASVSQPKRDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPIIPRLNQP
VRLVL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgctttataaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagcctcggc
caggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgctctaat
aaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctcgtcccc
gaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctggaagat
ttacccgtaccgacccttgccgccgtaaacggctatgcgctgggcggcgggtgtgaatgc
gtgctggcgaccgattaccgtctggcgacgccagacctccgtatcggcctgccggaaact
aaactgggcatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctgggcgcg
gacagcgcgctggagattatcgcggcaggtaaagatgtcggtgctgagcacgcgctgaaa
atcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgatagcggtg
ttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaactggaa
ccgttgaaactcagcaaaattgaagcagcgatgagctttactatcgctaaaggcatggtc
gcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccattgaagcc
gccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgttccgctg
gcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatatgtaaaa
ggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagccgtactgggc
gcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccggtcatc
atgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaagctgctg
aacaaacagctggaacgcggcaagatcgacggtctgaagctggcgggcgtcatttcgacc
atccacccgactctcgattatgccggtttcgatcgtgtagatgttgttgtcgaagcggtg
gtcgaaaatcccaaagtcaaaaaagcggtactggcggaaaccgagcagaaagtgcgcccg
gaaaccgtgctggcctcaaatacctctaccatcccgattggcgaactggcaagcgccctg
gaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatgccgctg
gttgaaatcattcgcggcgagaagagttcagacgaaaccattgccaaagtcatcgcctgg
gcaagcaaaatgggcaagacgccgattgtagtcaacgactgccccggcttctttgttaac
cgcgtgctgttcccctatttcgccggtttcagtcaactgctgcgcgacggcgcggatttc
cgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcctatctg
ctggatgttgtcggcattgataccgcgcatcacgcgcaggcggtaatggcggcaggcttc
ccgcaacggatgcagaaagagtatcgcgatgcgatcgacgctctgtttgatgctaaccgt
ttcggacagaaaaacggtctgggcttctggcgctataaagaagacagcaaaggcaagccg
aagaaagaagaagatgccgcggtggatgacctgctggcaagcgtcagccagccgaaacgc
gacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaagtggtt
cgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacagggcagc
gcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgaagtgccg
gaagggctgcgtaataaagcgcgccataacgaacctattatcccccggttgaaccagccc
gtccggttggttctctga

DBGET integrated database retrieval system