KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_0607Help
Entry
SPUL_0607         CDS       T01740                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00564  Glycerophospholipid metabolism
sel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPUL_0607 (glpA)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SPUL_0607 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 Pyr_redox_2 FAD_oxidored DAO_C Thi4 3HCDH_N HI0933_like NAD_binding_8 FtsA Pyr_redox_3 Pyr_redox Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AET53025
LinkDB All DBs
Position
complement(658097..659725)
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQASDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRISRHCVEPTDGLFITLPEDDLAFQATFIRACEAAGIRAEA
IDPQQARIIEPSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGAIVLTAHEVTGLIRE
GATVCGVHARNHLTGETQTLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDSNRVTADEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCITADTPLPGSKESTEHTLKRIISLPAPLRGSAVYRHGDRTP
GWLSEGRQHRSLVCECEAVTAGEVQYAIENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSEFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEHQD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaagcaagtgacgtgattatcattggcggtggagcaacaggc
gcagggatcgcccgcgactgcgcgctgcgcggtttacgtgtcattctggtggaacggcat
gatatagcgaccggcgcgaccgggcgtaaccacggactgctgcacagcggcgctcgttat
gcggttaccgacgcggaatccgcgcgcgagtgcattagtgaaaaccagattttaaaacgg
atctcccgccattgcgtcgaaccgacggatggtctgtttattacgttgccggaagatgat
cttgcgtttcaggccacctttattcgcgcctgtgaagcggcgggcattcgcgctgaagcc
atcgatccgcagcaggctcgcatcatcgaaccttccgttaaccctgcgctcatcggtgcg
gtaaaagtgccggatggcaccgtggaccctttccgccttaccgccgccaatatgctggat
gccagagaacatggcgcaatcgtgttaacggcgcatgaagtgaccgggctcattcgtgaa
ggcgcaacggtctgcggcgtccatgcgcgcaaccatctcactggcgaaacccagacgctt
cacgcgccggtggtggtcaatgcggctggtatctgggggcaacggatcgccgaatacgcc
gacctgagtattcgcatgttcccggcgaaaggctcgctgttgatcatggaccatcggatc
aaccagcatgtcattaaccgctgccggaaaccatcggatgccgacattctggtacctggc
gatacgatttcattgatcggcactacctctacccatattgattacaatgagatagacagc
aaccgcgtcaccgcagatgaagtcgatatcctgctgcgtgaaggggaaaaactggcccct
gtcatggcgaaaacgcgtattctgcgcgcgtattccggcgtccgcccgctggtggccagc
gatgacgatcccagcggtcggaacgtcagccgcggtattgtgttgttcgaccacgccgaa
cgcgacgggcttgatggcttcattaccattaccggcgggaagctaatgacttaccgcctg
atggcggaatgggcgaccgacgccgtgtgccgcaagttgggcaatactcgcccctgcatc
acggcagatacgccgttgcctggctcaaaagagtccacggaacatacgctgaaacgcatt
atctcgcttcccgcgccgctacgcggatcggcggtttatcggcatggcgatcgcacgccg
gggtggctgagtgaaggccgccaacaccgtagcctggtctgtgaatgcgaggccgtcacg
gcgggggaagtgcagtatgccatcgaaaacttaaccgtgaatagcctgctggatctgcgc
cgtcgcacccgcgtagggatgggcacttgccagggcgaactgtgcgcctgccgcgcggcc
gggctattgcagcgttttaatgtgacgaccgcggcgcaatctattacgcaactctctgaa
tttctgaatgagcgctggaaaggcgtacaacctgtcgcctggggagacgcgctgcgcgaa
agcgaattcacgcgctgggtttatcagggattatgcggtctggagaaggagcaccaggat
gaaatttga

DBGET integrated database retrieval system