KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2216Help
Entry
SPUL_2216         CDS       T01740                                 

Gene name
aroG
Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthetase) phenylalanine repressible
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
sel01130  Biosynthesis of antibiotics
sel01230  Biosynthesis of amino acids
sel02024  Quorum sensing
Module
sel_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPUL_2216 (aroG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SPUL_2216 (aroG)
Enzymes [BR:sel01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     SPUL_2216 (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AET54533
LinkDB All DBs
Position
complement(2221281..2222333)
Genome map
AA seq 350 aa AA seqDB search
MNYQNDDLRIKEINELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGP
CSIHDPAAAKEYAARLLALRDELQGELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQIN
DGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLS
CPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKAPN
YSAQHVAEVKEGLIKAGLTPQVMIDFSHANSCKQFQKQMEVCADVCQQIAGGEKAIIGVM
VESHLVEGNQSLESGQPLTYGKSITDACIGWEDTDALLRQLSAAVKARRG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcagaacgacgatttacgcattaaagaaatcaacgagttattacctccggtc
gcgctgctggaaaagtttcccgccacggaaaatgcagcaaataccgttgctcacgcgcgc
aaagccatccataaaattctcaaaggcaatgacgatcgtctgctggtggtgatcggtcct
tgttcaattcatgatccggcagcggcgaaagagtatgccgcccgtttgctggcgctacgt
gatgagcttcaaggcgagcttgaaattgtcatgcgcgtctattttgagaaaccgcgtacc
accgtcggctggaaagggctgattaacgatccgcacatggataacagcttccagattaac
gacggtctgcgtattgcgcgcaaactgctgctggatattaacgacagcggcctgcctgcc
gccggcgaattcctcgatatgatcacgccgcaatatctggccgatctgatgagctggggc
gccattggcgcgcggactactgaatcccaggttcatcgcgaactggcgtctggcctctct
tgtccggtcggttttaaaaatggtactgatggcacgattaaagttgccattgacgccatc
aacgccgccggcgcgccgcattgcttcctctccgtcactaaatggggtcattcggcgatt
gtgaataccagcggcaacggcgactgccatatcattctgcgcggaggtaaagcgccaaac
tatagcgcgcaacatgttgctgaggtgaaagaaggcctcatcaaagcgggactgacgccg
caggtcatgatcgatttcagccatgccaactcctgtaagcaatttcaaaagcagatggag
gtttgcgccgatgtctgtcagcagatagcgggcggtgaaaaagcgattattggcgtgatg
gtagagagtcatctggtagaaggaaaccagagtctggaaagcggtcagccgctgacctac
ggtaaaagcattactgacgcctgtattggctgggaagataccgatgcgctgcttcgtcag
ttgtcggcagcggtaaaagcccgtcgcggctaa

DBGET integrated database retrieval system