KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2240Help
Entry
SPUL_2240         CDS       T01740                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00020  Citrate cycle (TCA cycle)
sel00190  Oxidative phosphorylation
sel00650  Butanoate metabolism
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
sel01120  Microbial metabolism in diverse environments
sel01130  Biosynthesis of antibiotics
sel01200  Carbon metabolism
Module
sel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sel_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPUL_2240 (sdhB)
   00650 Butanoate metabolism
    SPUL_2240 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPUL_2240 (sdhB)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPUL_2240 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SPUL_2240 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AET54557
LinkDB All DBs
Position
complement(2243938..2244657)
Genome map
AA seq 239 aa AA seqDB search
MMKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGV
CGSDGLNMNGKNGLACITPISALTQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKP
YLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAY
RFLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactcgaattttcgatttatcgttataacccggatgtcgataacgctccgcgt
atgcaggattacaccctggaaggcgaagaagggcgcgacatgatgctgctggatgcgtta
atccagcttaaagaaaaagatcccagcctttctttccgtcgttcctgccgcgaaggtgtg
tgcggttctgatggtttgaatatgaacggtaagaatggtctggcctgtattacccctatt
tcggcgctgactcagccgggtaagaagattgtgattcgcccgctgcccggtttgccggtg
atccgcgatttggtggtagacatggggcaattctacgcacaatatgagaagattaagcct
tacttattgaataatgggcaaaatccaccggctcgtgagcatctgcagatgccggagcag
cgtgaaaaactcgatgggctgtatgaatgtattctttgcgcctgttgctcaacatcctgc
ccgtcattctggtggaacccggataagtttatcggtccggcggggctgctcgcggcgtat
cgattcctgatcgatagtcgtgataccgagaccgacagtcgtctggaagggatgagcgat
gcattcagcgtattccgctgtcacagcattatgaactgcgtcagtgtatgtcctaaggga
ctaaacccgacgcgcgctatcggccatattaagtcgatgctgttgcagcgtagcgcataa

DBGET integrated database retrieval system