KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2241Help
Entry
SPUL_2241         CDS       T01740                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00020  Citrate cycle (TCA cycle)
sel00190  Oxidative phosphorylation
sel00650  Butanoate metabolism
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
sel01120  Microbial metabolism in diverse environments
sel01130  Biosynthesis of antibiotics
sel01200  Carbon metabolism
Module
sel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sel_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPUL_2241 (sdhA)
   00650 Butanoate metabolism
    SPUL_2241 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPUL_2241 (sdhA)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPUL_2241 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SPUL_2241 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AET54558
LinkDB All DBs
Position
complement(2244671..2246437)
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGVLRDASESDVEGSLERLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPERDDANWLCHTLYQPQTESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggccaaacctgtgcgctgctctcgaaagtcttc
ccgacccgttcccataccgtttccgcgcagggcggtatcaccgtggcgctcggcaatacc
catgaagataactgggaatggcacatgtacgataccgtaaaagggtcggactacattggt
gaccaggatgctatcgaatatatgtgtaagaccggaccggaagcgattctggaactggag
cacatggggctaccgttctcccgtcttgatgatggacgtatctatcagcgcccgttcggc
ggccagtcgaaaaactttggcggcgagcaggcggcacgtaccgcggcggcggctgaccgt
accggtcacgccttgctgcacacgttgtatcaacagaatttgaaaaaccacaccacgatt
ttctccgaatggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtggggtgt
accgcactgtgcatcgaaaccggtgaagtggtgtacttcaaagcccgcgcgacggtgctg
gcgaccggcggcgcaggccgtatctaccagtccaccaccaacgctcacatcaacaccggt
gacggtgtcggtatggcgctgcgtgccggtgtcccggtgcaggacatggaaatgtggcag
ttccacccgaccggcatcgccggggcgggcgtgctggtgacagaaggctgccgcggcgaa
ggcggttacctgctgaacaaacacggcgagcgctttatggagcgttatgcgccgaatgcc
aaagacctggcgggtcgtgacgtggtggcgcgttccatcatgatcgaaatccgtgaaggc
cgcggctgtgatggtccgtgggggccgcacgctaaactgaaactggatcacctgggtaaa
gaggtgctggaatctcgcctgccgggtatcctggagctgtcccgtactttcgcccacgtt
gacccggtgaaagagccgattccggttatcccgacctgccactacatgatgggcggtatt
ccgactaaagtgaccggtcaggcgctgaccgtgaacgagcagggcgaagacgtggtcatt
ccggggctgtttgcggtaggcgaaatcgcctgtgtatcggttcacggcgccaaccgtctg
ggcggtaactcactgctggatctggtggtctttggccgcgcggcggggctgcatttacag
gaatccatcgccgagcagggcgtgctgcgcgacgccagcgagtctgacgttgaaggttct
ctggagcgcctgaatcgctggaacaataaccgcaatggcgaagatccggtggctatccgc
aaagcgttgcaggagtgtatgcagcataacttctccgtattccgtgaaggcgacgcgatg
gcgaaagggcttgagcagttgaaagtgatccgcgagcgtctgaaaaacgcccgtctggat
gacacgtccagcgagtttaatacccagcgtgttgagtgtctggagctggataacctgatg
gaaaccgcctacgccactgccgtatcagccaacttccgaacggaaagccgcggcgcgcat
agccgcttcgatttcccggagcgtgatgatgccaactggttgtgtcataccctgtatcag
ccgcaaacggaatccatgacgcgccgaagcgtcaatatggagccgaaactgcgtccggcg
ttcccgccgaagattcgtacttattaa

DBGET integrated database retrieval system