KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_4054
Entry
SPUL_4054         CDS       T01740                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00564  Glycerophospholipid metabolism
sel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPUL_4054 (glpD)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SPUL_4054 (glpD)
SSDB
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Other DBs
NCBI-ProteinID: AET56283
LinkDB
Position
complement(4108062..4109570)
AA seq 502 aa
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGVRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATAARRENG
LWIVEAEDIDTGKKYVWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
NQKQAYILQNEDKRIVFVIPWMEEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
QKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLASYYPGIGPAWTKTCVLPGGDIDGSREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSLLDLGEDFGHEFYEAELKYLVDHEWVRRTEDAIWRRTKEGMWLTAE
QQSRITQWLAAYVEKHQLSMAS
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggaaaccaaagatctgatcgtgataggcgggggcattaacggtgcaggcatcgcggct
gatgccgccgggcgcggtttgtccgtactcatgctggaagcgcaggatttggcctgcgca
acctcttccgccagttcgaaacttatccacggcggcttacgctaccttgagcactacgag
ttccgtctggtcagcgaagcgctggcagaacgtgaagtgctgttgaaaatggcgccgcac
atcgccttcccgatgcgttttcgtctgccgcaccgcccgcatttacgtccggcctggatg
atccgtatcggtctgtttatgtacgatcacctcggcaaacgtaccagtttacccggttcc
accggtgtgcggtttggcgcagattcggtgctcaaaccggaaatcgtgcgcggattcgaa
tattccgactgctgggtagacgatgcgcgtctggtgctggctaacgcacagatggtggtg
cgtaaaggcggcgaagtccttacccgtactcgcgcaaccgccgctcgtcgggaaaatggc
ctgtggattgtcgaagcggaagatatcgacaccggtaaaaaatatgtctggcaggcgcgc
ggactggttaacgccaccggaccgtgggtcaaacagttcttcgacgaagggatgcacctg
ccgtcaccatatggcatccgcctgatcaaaggcagccatatcgtcgtgccgcgcgtccat
aatcagaagcaggcgtatattctgcaaaacgaagataagcgtatcgtctttgtcattccg
tggatggaagagttttcgatcattggcacgaccgatgtcgaatataaaggcgatccgaaa
gcggtaaaaattgaagagagcgaaattaattacctgttgaaggtttataacgcgcacttc
cagaaacaactggggcgcgatgacatcgtctggacgtactccggcgtccgtccgctgtgc
gatgatgagtccgactcaccgcaggcgatcactcgcgattatacccttgatattcatgat
gaaaacggcaaagcgccgctgctttccgtgtttggcggtaagctcacgacctaccgtaag
ctggctgaacacgcgatggaaaaactggcgtcttattatccaggcatcggcccggcatgg
accaaaacgtgcgtactgcccggcggcgacatcgacggcagccgcgaagattacgcggcg
aagctgcgtcgtcgttatccgttcctgacggaatcgctggcgcgccactattcgcgcact
tacggcagcaacacggagtggattctcggcgaagccacgtcgctgcttgatttaggcgaa
gatttcggtcatgagttttacgaggcggaactcaagtacctggtggatcacgaatgggtg
cgccgtactgaagacgctatctggcgtcgcaccaaagaaggcatgtggctgaccgccgaa
cagcagtcccgcatcacccagtggctggcggcgtatgttgagaaacaccaactttcaatg
gcgtcgtaa

DBGET integrated database retrieval system