KEGG   Selenomonas sp. oral taxon 478: ADJ74_01590Help
Entry
ADJ74_01590       CDS       T04017                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sele  Selenomonas sp. oral taxon 478
Pathway
sele00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sele01100  Metabolic pathways
sele01110  Biosynthesis of secondary metabolites
sele01130  Biosynthesis of antibiotics
sele01230  Biosynthesis of amino acids
Module
sele_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sele00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ADJ74_01590
Enzymes [BR:sele01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ADJ74_01590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 AAA AAA_5 AAA_16 Cytidylate_kin2 CPT PduV-EutP
Motif
Other DBs
NCBI-ProteinID: AKT53246
UniProt: A0A0K1FFQ6
LinkDB All DBs
Position
1:complement(331240..331761)
Genome map
AA seq 173 aa AA seqDB search
MKNIVLIGFMGTGKTSVGRLLAGRLGCAFHDLDRKIEEACGISIPQIFAQYGEPYFRARE
KEAVRAAAARSGLVIATGGGTVKDAENAAILRKNGVLVALTADVDTILQRTAARGARPVL
DGADAGDRRAAVVQLLEERRTLYAGADITVDTSRRSPLEVAEYIVQATRIWRK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacattgtactgattggctttatggggacgggcaagacgagcgtcgggcgcctc
ctagcgggacggctcggctgcgcctttcacgatctcgatagaaaaattgaggaagcgtgc
ggcatctccattccgcagatattcgcgcagtacggcgagccgtactttcgcgcacgggag
aaggaagccgtgcgcgccgccgccgcacggagcgggctcgtcatcgcaacgggcggcggg
acggtcaaggatgcggagaacgctgcgattctgcgcaaaaacggtgtccttgttgcgctg
actgccgatgtcgataccatcctgcagcggacggcggcacgcggcgcgcgtcccgtgctt
gacggcgccgatgcgggcgaccgccgtgctgctgttgtgcagctgctggaggaacgccgc
accctctatgcgggggcggacattacagtggatacgagccgtcgttcgccgctcgaggtg
gcagagtacatcgtacaggcgacgcggatatggagaaagtga

DBGET integrated database retrieval system