KEGG   Selenomonas sp. oral taxon 478: ADJ74_06860Help
Entry
ADJ74_06860       CDS       T04017                                 

Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
sele  Selenomonas sp. oral taxon 478
Pathway
sele00471  D-Glutamine and D-glutamate metabolism
sele00550  Peptidoglycan biosynthesis
sele01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sele00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ADJ74_06860
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ADJ74_06860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sele01011]
    ADJ74_06860
Enzymes [BR:sele01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     ADJ74_06860
Peptidoglycan biosynthesis and degradation proteins [BR:sele01011]
 Precursor biosynthesis
  Amino acid ligase
   ADJ74_06860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Mur_ligase_M Mur_ligase_C Mur_ligase Dala_Dala_lig_N ATP-grasp_3 RimK GARS_A CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: AKT54924
UniProt: A0A0K1FJT0
LinkDB All DBs
Position
1:1464462..1466810
Genome map
AA seq 782 aa AA seqDB search
MLKELKGIQKIHFVGIGGAGMSPLAKILLQLGYTVSGSDTGDSPLIGELARLGAHVWTDG
QHAEHVRGADAIVVSTAIPYDNPEVIAAWDLRIPKLHRSDINAALVNEYDGIAVAGSHGK
TTTTSMIGVTLDHVGASPTIIVGGEVPDLGTNAKLGTSRYLVSEADESDGSFLKLRPHIA
VVTNVEDDHMDHYGTMEKIIAAFRQFIEQVDTDGAAVLCFENANLRNIARETKRCVVSYA
IDYEADYRASDIETRGSVISFTVHEHGTEMGRVLLNIPGRHNVLNALACIAVARLAGVEF
PAICDALAQFHGAKRRFQTKGKERGVWVVDDYAHHPTEIAVTLAAARQTNPERLICVFQP
HRYSRTQLLRAEFGKCFADADLLLITDVYAAGETPIPGISGETVMEEVVRQTGQDVVYLP
DRADLERYLAQQVRAGDLVITMGAGNILEVGETLVAQLRAGTAGTAGIAESDAHPIVVVM
GGPSSEAEVSRRSGAAILQALCAKGYPAVGMELNPATFAEEIQALHPAIVFNALHGKYGE
DGILQGTLDMLGIPYTGSGVRAAALTMDKIMAKRVLAAEDIPTPRCMSFYASERTADTPR
EIRTAFSLPLVVKAPEQGSSIGVYIVTRDEELSPALDAAFSYGDEVLVEEFIEGRELTVA
VWGTPAAAEVMPVIEIRSVSGRYDYDSKYTPGASTHIVPAPLSDACRSEVEQLARRAYAA
CGCSGLARVDLLLSAENRPYVIELNAVPGMTETSLVPDAARALGIEFPELCERILALAGY
RR
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
ttgctcaaggaattgaaggggattcagaagattcattttgttggaatcggcggggcgggg
atgagccccttggcaaagatcctcctccagctcggctacacggtatccggctcggacacg
ggcgactctccgctcatcggcgagcttgcccgtctcggtgcgcatgtgtggacggatggt
cagcatgcggaacacgtgcgcggagcagatgccattgtcgtctccacggcgatcccgtac
gataatcctgaggtgattgcggcatgggatctgcgcatccccaagctccatcgttcggac
atcaatgcggcactcgtcaacgagtacgacggtatcgccgtcgcgggctcgcacggcaag
acgacgacgacctccatgatcggtgtgactctcgatcacgtcggcgcatcgccgaccatc
atcgtcggcggtgaggtgcccgacctcgggacgaatgcgaagctcggcacgagccgctac
ctcgtctcggaggcggatgagagcgacggctccttcctcaagctgcgcccgcatatcgcc
gttgtgaccaacgtcgaggacgaccacatggatcactacggcacgatggagaagatcatc
gcggcgttccgtcagttcatcgagcaggtggatacggacggtgcggcggtgctctgcttt
gaaaatgcaaatctgaggaatattgcgcgtgagacaaagcgctgtgtcgtttcctatgcc
attgactatgaggcggactatcgtgcatcggacatcgagacgcgtggctctgtgatctcg
tttaccgttcatgagcacgggacggagatggggcgcgtgctgctcaatattccggggcgc
cacaacgtcctcaacgcactcgcctgtatcgccgttgcgcgcctcgcgggtgtggagttc
cctgcgatttgtgacgcactcgcccagttccacggtgcgaagcgtcgcttccagacgaag
ggaaaggagcgcggcgtctgggtcgtggacgactatgcgcatcatccgacggagatcgcc
gtcacccttgcggcagcacggcagacgaaccccgagcggcttatctgcgtctttcagccg
catcgctactcgcggacacagctcctgcgcgcggagtttggaaaatgctttgcggatgcc
gacctgcttctgatcacggatgtctatgcggcaggagagacaccgattccgggcatcagc
ggtgagaccgtgatggaggaagtcgtgcgtcagacgggacaggacgttgtctacctgccg
gaccgtgcggatctcgaacgctatctcgcccagcaggtgcgtgcgggcgacctcgtcatc
acgatgggcgcgggcaacatcctcgaggtcggtgagacactcgtcgcgcagctgcgcgca
ggaacagcggggacggcaggtatcgcggagtcggatgcgcatccgatcgtcgtcgtcatg
ggcggcccctcctccgaggcagaggtctcgcgccgctcgggtgctgccatcctgcaggca
ctctgcgccaagggctatcccgccgtcggcatggagctgaaccccgcgaccttcgccgag
gagattcaggcactccatcccgcgattgtgttcaacgcccttcatggaaaatacggcgag
gacggcatcctgcagggcacgctcgacatgctcggcattccgtatacgggctcgggtgtg
cgcgccgccgcgctgactatggataaaatcatggcaaagcgcgtactggcggccgaggac
atcccaacgccacgctgcatgagcttctatgcgagcgagcgcacggcggatacgccgcgt
gagatacggactgcattctccctgccgctcgtcgtcaaggcaccggagcaggggtcgagc
atcggcgtctacatcgtcacgcgggacgaggagctctcgccagcgctcgatgcggcgttc
tcctacggggatgaggtgctcgtcgaggagttcatcgaggggcgagagctgaccgtcgct
gtctggggtactccagccgcggcagaggtcatgcccgtcatcgagatccggtctgtttcg
gggcgctatgactacgacagtaagtataccccgggggcatcgacacatatcgtcccggca
ccgctctccgatgcgtgccgcagcgaagtcgagcaactggcacgccgtgcgtacgccgcc
tgtggctgcagcggtctcgcgcgcgttgatctcctgctgagcgcagagaatcgtccctac
gtcattgagctgaacgccgtaccgggcatgacagagacctcgcttgtcccagatgcggcg
cgtgcgctcggcatcgagttccccgagctgtgcgaaaggatcctcgcgttggcggggtat
cggcgatga

DBGET integrated database retrieval system