KEGG   Selenomonas sp. oral taxon 136: AXE86_00015Help
Entry
AXE86_00015       CDS       T04745                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
selo  Selenomonas sp. oral taxon 136
Pathway
selo00970  Aminoacyl-tRNA biosynthesis
selo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:selo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AXE86_00015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:selo03029]
    AXE86_00015
Enzymes [BR:selo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AXE86_00015
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AXE86_00015
Mitochondrial biogenesis [BR:selo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AXE86_00015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AME02603
UniProt: A0A0X8K8R8
LinkDB All DBs
Position
complement(2143..3582)
Genome map
AA seq 479 aa AA seqDB search
MKYETVIGLEIHCELKTKTKIFCGCATGFGTPQNTHVCPVCLGLPGVLPVVNREVVHFAI
KAGLATNCTINGYSKFDRKNYYYPDLPKNFQTSQYDLPIAEHGWVDIDTEEGKKRIRLTR
IHMEEDAGKLVHSGTTIKDSASSNVDYNRTGVPLLEIVSEPDMSSAEEARAYMEKIKSIM
EYIDVSNCRMEEGNLRADINVSLRPVGSDQLGTRTEMKNINSFKALEDAINYEIERQTEV
LEDGGHIVQETRTWDPERGMTLSMRSKEEAHDYRYMPEPDLPPIVTSEEEIEAVRRELPE
LPDARRMRLMDEAGLSAYDAGIITSSRAMAEYYDAIVATGADAKLAANWLMGDLSKNLNA
EGKTIEDSPVDAKRLGEMILLIAKGTISSKIGKTVFKAMWTSPDAPEKIVKDKGLIQITD
TKEIEGIVDQVIAANAKAVEDYKGGNKKAIGALVGQVMKQSKGKANPQMVNELLAKKLG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgaaaccgtcatcggccttgagattcactgcgagctcaagacaaagaccaag
atcttctgcggctgtgctacggggttcggaaccccgcagaacacacatgtctgtcccgtc
tgcctcggtctgcccggcgttctccctgtcgtcaaccgtgaggtcgtccatttcgccatc
aaggcggggctggcgacgaactgcacgattaacggatacagcaagtttgaccgcaagaat
tactactatccggatttgccgaagaacttccaaacctcgcagtacgacctgcctatcgcc
gaacatggctgggtggatatcgatacggaagaggggaagaagcgcattcgcctgacgcgc
atccacatggaggaggacgcaggaaaactcgttcactccggtacgacgattaaggattct
gcttcgtccaatgtggactacaaccgcactggcgttcccctgcttgagattgtctccgag
cccgatatgtcctcagccgaggaggcacgtgcctacatggagaagatcaagtcgatcatg
gagtatattgatgtctcgaactgccgcatggaggagggcaatctccgtgcggacatcaac
gtctccctgcgtcctgtcggctcagaccagctcggcacacggacggagatgaaaaacatc
aactccttcaaagcgttggaagatgcgatcaactatgagatcgagcgtcagacggaggtg
ctcgaggacggcggacacattgtgcaggagacacgcacgtgggatccagagcgtggtatg
acactctccatgcgcagcaaagaggaggcgcatgactaccgttatatgccggagcccgat
cttccgcccatcgtgacgagtgaagaggaaattgaggcggtacggcgtgagctgccggag
ctgccggacgcccgtcgcatgcgtctgatggacgaggcaggactctccgcatacgatgcg
ggcatcatcacgagctcgcgtgcgatggctgagtactatgatgccattgttgcaacagga
gcggatgcaaaactggcggcaaactggctgatgggcgatctctccaagaacctgaacgca
gaagggaaaacgatcgaggactctcctgtcgatgcaaagcgcctcggcgagatgattctc
ctcatcgcaaaggggacgatttcttctaagatcggcaaaaccgtgttcaaggcaatgtgg
acatctcctgatgctcccgagaagatcgtcaaggacaaggggctcatccagattacggac
accaaggagatcgaaggcatcgtcgatcaagtcattgctgccaatgcaaaggcggtagag
gactacaagggcggcaataaaaaggcgattggtgccttggtcggacaagtgatgaaacag
tccaagggcaaggcaaacccgcagatggtcaatgaacttttggcaaaaaaacttggctga

DBGET integrated database retrieval system