KEGG   Selenomonas sp. oral taxon 136: AXE86_02395Help
Entry
AXE86_02395       CDS       T04745                                 

Definition
(GenBank) ABC transporter permease
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
selo  Selenomonas sp. oral taxon 136
Pathway
selo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:selo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AXE86_02395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:selo02000]
    AXE86_02395
Transporters [BR:selo02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AXE86_02395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_22 DUF87 AAA_29 RsgA_GTPase NACHT AAA_30 ATP-synt_ab AAA_24 ATPase AAA_23
Motif
Other DBs
NCBI-ProteinID: AME03024
UniProt: A0A109WCT5
LinkDB All DBs
Position
527102..528718
Genome map
AA seq 538 aa AA seqDB search
MMTTMLFRLLSIAAPAAALPALLAGFLAAAAGISLIASAAWIIASAALAPPLSALALAIT
CVRACGIGRAVFRYLERLLSHRLAFGCYETLQQATYRRSAAVIPMREGNVREGEFLHDLL
TGCETLRDFYLRAVPPPLIALALVLLACAALLPLSIPAATVVFLLFLLHIALPLFLRETE
LRAQSADYRSSLLDQIDGRTELRAAGSTQHAQAVLDEAAATFQRERTARGRKREQLFTLL
DVLRIIVWIAAIILLIPRVIEGILTGIQYAVWVLALEAVLAELRPIPPAVLGAQESARAA
RHILPSDGEHTQPASIAPPSEKSANAPLIEAKHLVFGYHTGIPIVQNLSLTIHRGEHTAI
IGESGAGKTTLASLLLRLWEPDAGTISYDGIPHTKLPLEASRTYFGAALQGSWLFSASIR
DNFLRLRGDISEAAIWHALETAQLADVVRALPAGLDEPLGMNASRLSGGQRSRLLTALAL
AGDAPILLLDEPTAGLDAACGTRLITSVLADADARGATLIVITHDLPLLNQMKQVIKL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccacaatgctctttcggctgctctccatcgccgcacctgcggcggcactcccc
gccctcctcgcgggattcctcgcggccgcggcgggcatttccctcattgcctctgcggcg
tggatcatcgccagtgcggcactcgcgccgcccctctcggcacttgcccttgccattacc
tgcgtgcgggcgtgcggcatcgggcgcgccgtctttcgctacctggagcgcctgctctct
caccgtctcgccttcggctgctacgagacgctgcagcaggcgacctaccgccgctcggcc
gccgtcattcccatgcgagagggcaacgtacgcgagggcgagttcctccacgatctgctg
acgggctgtgagaccctgcgcgacttctacctgcgcgccgtcccgccgccactgatcgcc
cttgccttggtgctgctcgcctgtgcggctctcctgccgctcagcatccctgcggccaca
gtcgtattcctgctctttctactccacattgcgctcccgctcttcctccgcgaaacggaa
ctgcgcgcgcaaagtgccgactatcgcagcagcctcctcgatcagatcgacgggcgcacc
gagctgcgcgccgccggcagtacacagcatgctcaggcagtgctggatgaggcggcggcg
acatttcagcgcgagcgaacggcacgagggcggaaacgcgagcagctcttcaccctgctc
gacgtcctgcggatcatcgtctggatcgcagccatcatcctcctcatcccccgcgtgatc
gaagggatcctcacgggtatccagtacgcggtctgggttctcgccctcgaggcggtactc
gccgagctccgcccgatcccccccgccgttctcggcgcacaagaatcggcgcgtgccgca
cgacacattctcccatcagacggcgagcacacacagcccgcctccatcgcacccccttcc
gaaaaatcagcaaacgcacctctgatcgaggcgaaacacctcgtcttcggctatcataca
ggcatccccattgtgcagaacctcagccttacgatccaccgcggcgagcacacggccatc
atcggcgagagcggcgcaggcaagacgacgctggcgagccttctgctccgcctctgggag
cccgatgcgggcacgatctcctacgatggtattccccatacgaagctccctctcgaagcg
tcgcgcacctattttggtgctgccctacagggcagctggctcttctctgcctccatacgg
gacaattttctgcgcctgcgcggtgatatctctgaggcagcaatatggcacgcactcgaa
acggcgcagctcgcagacgttgtgcgggcgctgcccgcagggctcgacgagccgctcgga
atgaacgcctcccgtctttcggggggacagcgcagccgcctgctcaccgcacttgcactc
gcgggcgatgcgccgatcctgctcctcgatgagccgacagcagggctcgatgctgcctgc
ggtacacgcctcatcacatccgtcttggcagatgccgatgcacgcggcgcaacgctcatc
gtcatcacacacgatctgccccttttgaatcaaatgaaacaggtgataaaactatga

DBGET integrated database retrieval system