KEGG   Selenomonas sp. oral taxon 136: AXE86_03265Help
Entry
AXE86_03265       CDS       T04745                                 

Definition
(GenBank) iron ABC transporter substrate-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
selo  Selenomonas sp. oral taxon 136
Pathway
selo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:selo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AXE86_03265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:selo02000]
    AXE86_03265
Transporters [BR:selo02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    AXE86_03265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_6 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AME03186
UniProt: A0A0X8K9U3
LinkDB All DBs
Position
complement(717680..718735)
Genome map
AA seq 351 aa AA seqDB search
MKRMKKWLSVLAVAAVAGTMLAGCGGGTDKKAAGGEEEKVLTVYTARSESLNNLVIPNFE
KDTGIKVNVIVAGTGPLLKRVASEKGNPQGDILWASDQMTLESQKDLFMEYVSPEDANMM
EAFRNKTGYFSPAFADPTVMIVNKNLAGDMKIDSFEDLLNPALKGKIAFGDPAASNSALQ
SLIAMLYAKGTNGDPMSDTAWAYVDQFIANLDGKILNSSGGVHKGVADGEYTVGLTWEDP
AATYVKNGAPVRVVFPKEGAIFPGESVQIIKDCKHPENAKKFVDYMLSQKIQEAAGKELT
VRPLRKDVPLASYMTPMKDIALFPNYDEGWVAQHKNEIVAMWNKHLENFKQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggatgaagaagtggctgtccgtcttggcggtggctgcagtcgcgggaacgatg
cttgcaggctgtggtggcggcacggacaagaaggcggcaggcggcgaggaggagaaggtg
ctcacggtctatacagcacgcagtgagagcctaaacaatctcgtcatcccaaattttgaa
aaggacacgggcatcaaggtcaatgtcattgttgcagggacgggaccgctcctcaagcgc
gtggcttcggagaaggggaacccacagggggatattctctgggcatcggatcagatgacg
ctcgagtcgcagaaggatctctttatggagtatgtctcccctgaggatgcgaatatgatg
gaggcgtttcgcaataagacgggatacttctctcctgcctttgctgatccgaccgtcatg
atcgtcaataagaatctggcgggggatatgaagatcgacagctttgaggatcttctcaat
cctgccttgaaggggaagatcgccttcggtgatccagcagcatcgaattcggcattgcag
tcactgatcgccatgctctatgccaaggggacgaacggtgaccctatgtcggatacagca
tgggcatacgtcgatcagttcatcgcaaatctcgacggtaagatactgaacagctcgggc
ggcgtccacaagggtgtggcggacggtgagtatacggttggtctcacgtgggaggatcct
gcggcaacctatgtgaaaaatggtgctcctgtgcgtgtggtcttccccaaggaaggtgcg
atcttccccggtgagtcagtacagatcatcaaggactgcaagcatccggaaaatgcaaag
aagttcgttgactatatgctctcgcagaaaattcaggaagcagccggcaaggagctgacg
gtgcgccccctgcgcaaggatgtgccgctcgcatcttatatgacgccgatgaaggacatt
gcactcttcccgaactatgacgagggatgggtagcacagcataagaatgagatcgttgca
atgtggaataagcatctcgagaatttcaaacagtag

DBGET integrated database retrieval system