KEGG   Selenomonas sp. oral taxon 136: AXE86_07080Help
Entry
AXE86_07080       CDS       T04745                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
selo  Selenomonas sp. oral taxon 136
Pathway
selo00040  Pentose and glucuronate interconversions
selo00051  Fructose and mannose metabolism
selo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:selo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AXE86_07080
   00051 Fructose and mannose metabolism
    AXE86_07080
Enzymes [BR:selo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     AXE86_07080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C Polysacc_syn_2C Pyr_redox_2 Pyr_redox Shikimate_DH 2-Hacid_dh_C TrkA_N HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AME03846
UniProt: A0A0X8KB50
LinkDB All DBs
Position
1470561..1471658
Genome map
AA seq 365 aa AA seqDB search
MKAAIYHGTADVRVEEVAKPVIGAGELLVKVKACAICGGDLRTFRHGHKAIHPPIILGHE
IAGVIEEVGAGIERYHVGDRVIVAPGIGCGACSYCLSGRQHLCYTRETIAHHYDGGFAEY
VRIPANAVRAGNVNFIPDEVDYLAASLSEPLACVINGQEAMDIQLGDTVAVIGAGPIGIM
HAELARARGAGKIFLLNRSKNRLDAARDLNYDAYTETGEDGGVQAVLDATNGLGANVVIV
TAGSATAQRAGIEMTGKMGKVCLFAGLPKDTPELTFDVNFVHYRQITLYGTFSSAPRHNA
LAVELIRSGKINADRILTHAVSLDDIVHGFDLVEHRAGMRVAVVPHLEELAEDLARHPDL
VVSKG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaatatatcacggcacggcagacgtgcgcgtggaggaggtcgcaaaacct
gtgatcggtgcgggggagctactcgtcaaggtcaaggcatgcgcgatctgcggcggcgat
cttcggaccttccgccacgggcataaggcgatccatccgcccattattctggggcatgag
atcgcaggtgtgatcgaggaggtcggtgcgggcattgagcgctaccatgtaggagatcgc
gttattgtggcacccggtatcggctgcggtgcatgctcttactgcctttcgggacggcaa
catctgtgctatacgcgcgagaccattgcgcatcactatgacggcggctttgcggagtat
gtgcgcatccctgcgaatgccgtccgcgcgggcaacgtcaattttatccccgatgaggtt
gactacctcgccgcatcgctctcagagcccctcgcctgtgtcatcaacgggcaggaggcg
atggatattcagctgggcgatacggtggcggtcatcggtgccgggccgatcggtatcatg
catgcagagcttgcgcgtgcgcgcggcgcagggaagatcttcctgctgaaccgcagtaaa
aatcgtctggacgcggcacgtgacctaaactatgatgcctataccgagacgggggaggac
ggcggcgtgcaggccgtcctcgacgcgacgaacgggttgggggcgaatgtcgtcatcgtg
acagcaggaagtgccacagcacagcgcgcaggaattgaaatgacggggaagatgggtaag
gtctgcctctttgcgggattgccgaaggatacgccggaactgacctttgatgtcaatttt
gtccactaccgtcagattacgttgtatgggacattctcctccgctccgcgccacaacgca
cttgccgtggagctgatccgcagcggcaagatcaatgcagaccggattctcacccatgcg
gtctcactcgatgatattgtgcatgggtttgatctggtggagcatcgggcggggatgcgc
gtcgccgttgtaccgcacctagaggaactcgcagaggatcttgcacgacatccggatctt
gtcgtctcaaagggatga

DBGET integrated database retrieval system