KEGG   Selenomonas sp. oral taxon 920: BCS37_10505Help
Entry
BCS37_10505       CDS       T04818                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
selt  Selenomonas sp. oral taxon 920
Pathway
selt00010  Glycolysis / Gluconeogenesis
selt00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:selt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCS37_10505
   00500 Starch and sucrose metabolism
    BCS37_10505
Enzymes [BR:selt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BCS37_10505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF3226
Motif
Other DBs
NCBI-ProteinID: AOH48845
UniProt: A0A1B3X6J3
LinkDB All DBs
Position
complement(2203465..2204868)
Genome map
AA seq 467 aa AA seqDB search
MAFPKEFLWGGAVAANQCEGAYNADGKGLDIQDIMPRGITGAPTQEPTADNLKLTAIDFY
HRYKGDIALFAEMGFKVFRTSIAWSRIYPNGDDAEPNEAGLQFYDNLFDECRKYGIEPLV
TISHYETPLHLAKTYNGWMSHDLIGFYERYVRTIFTRYRDKVKYWLTFNEINSVLHEPLL
SGGIMTPKAELSLQDLYQACHHEFVASALATKIGHEIIPEAQIGCMILAMPTYPLTPAPD
DMIAVMRAEHFNDFFGDMHVRGIYPGYMKRYFRENGIEIRATQEELRLLREHTVDFVSFS
YYVSICEGAGGTAGGGNLLGGKKNPYLKASEWGWQIDPQGLRYVLNRYYDRWQKPLFIVE
NGLGAKDVLVADGAGGRTVADDYRIDYLNDHLVQVAEAIADGVPVMGYTTWGCIDLVSAS
TAQMSKRYGFIYVDRNDDGSGTLARYRKKSFHWYKDVIATNGECLKW
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcattcccaaaggaatttctctggggcggtgcagtcgcggcgaatcagtgtgagggc
gcgtacaatgcggacggcaagggactcgacatacaggacatcatgccgcgcggcatcacg
ggcgcaccgacgcaggagccaacggcggacaatctgaaactcacggcgattgacttctac
catcggtacaagggggacattgccctctttgccgagatggggttcaaggtgttccgcacg
tcaattgcgtggagccgcatctacccgaacggggacgatgccgagccgaacgaggcgggg
ctgcagttctacgataatctcttcgacgagtgccggaaatacggcatcgagccgctcgtg
acaatctcgcactatgagacgccgcttcaccttgcgaaaacatacaacggctggatgagt
cacgacctcatcggcttctacgagcggtatgtgcggacgatcttcacgcgctatcgggat
aaagtaaaatactggctgacgttcaacgagatcaactccgtactccatgagccgctgctc
tcgggcggcatcatgacgccgaaggcggagctgtcgctccaagacctctatcaagcgtgt
caccatgagttcgtcgcctcggcgcttgcgacgaagatcgggcatgagatcatccccgag
gcacagatcggctgtatgattctcgcgatgccgacctatccgctgacccccgcgcccgac
gatatgatcgccgtcatgcgggcggagcacttcaacgacttcttcggcgatatgcacgta
cgcggcatttaccccggctatatgaaacgctacttccgcgagaacggcatcgagatccgc
gcgacacaggaggagctgcggctgctgcgggaacatacagtggacttcgtctcgttcagc
tactacgtcagcatctgcgagggtgcgggcggaacggcgggcggcggcaatctcctcggc
gggaagaagaacccgtatctaaaggctagcgaatggggctggcagatcgacccgcagggg
ctgcgctatgtgctcaatcgctattatgaccgctggcaaaagccgctctttatcgtcgag
aacggccttggggcgaaggatgtgctcgtcgcggacggggcgggcggcaggacggtcgcg
gacgactaccgcatcgactatctgaacgatcatctcgtgcaggtcgcggaggcaatcgcc
gacggcgtgcccgtcatgggctatacgacgtggggctgcatcgacctcgtgagcgcgtcg
acggcgcagatgtcaaagcggtacggcttcatctacgtcgaccgcaatgacgacgggtcg
ggaacgctcgcacgataccgcaagaagtcgtttcactggtataaggacgtgatcgcgacg
aacggggaatgtttgaagtggtga

DBGET integrated database retrieval system