KEGG   Selenomonas sp. oral taxon 920: BCS37_10905Help
Entry
BCS37_10905       CDS       T04818                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
selt  Selenomonas sp. oral taxon 920
Pathway
selt00440  Phosphonate and phosphinate metabolism
selt01100  Metabolic pathways
selt01120  Microbial metabolism in diverse environments
selt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:selt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BCS37_10905
Enzymes [BR:selt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BCS37_10905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AOH48902
UniProt: A0A1B3X6P8
LinkDB All DBs
Position
2276906..2278201
Genome map
AA seq 431 aa AA seqDB search
MKHVYTCFCTDIIHAGHRNLLRAAAELGEVTVGVLSDPEMVRYNRFPTKTLAERMEMIRA
LPEVTQVIVQEHIMYDEVIDRLRPNYVVHGSNWAQGPESSIRKNVLAALARYGGELIEPP
YTENAEVRKIDWQMREQLAMPEARRGRLRRLLEIVPIVKTIEVHNGLTGLIAEKTVVEND
GGLDQFDAMWVSSLCDSTSRGKPDIELVDLSDRIQTINEVMEVTTKPIILDMDTGGTAEH
FAYNVRTLERIGVSAVIIEDKTGAKRNSLFGTEVAQTQDTIENFSEKIAAGKAAQRTEEF
MIIARIESLILEKGLDDALERAEGYVAAGADGIMIHSRAKSPDEVIAFCDAFRAKHPNVP
IVAVPSSYNTITEAELAAHGVRIVIYANQLTRAAFPAMEGAARSILTHHRAHEIDSALLP
IKDIIRLIEVV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgtttacacttgcttctgcaccgacatcatccacgcgggacaccgcaacctc
ctgcgtgcggcggcagagctgggcgaggtcacggtcggcgtgctctccgatccggagatg
gttcgctacaaccgctttccgaccaagacgctcgccgagcgcatggagatgatccgcgca
ctgcccgaggtcacacaggttatcgtgcaggagcacatcatgtacgacgaggtcattgat
cgcctgcgccccaactacgtcgtgcacgggagcaactgggcgcagggacccgagtcgtcg
atccgcaagaacgtgctcgccgcactcgcgcgttacggcggcgagctgatcgagccgccc
tatacggagaatgccgaggtgcgcaagatcgactggcagatgcgtgagcagctcgcgatg
cctgaggcacggcgcggacggctgcgccgcctcctcgagatcgtccccatcgtaaagacc
atcgaggtgcacaacggactcacggggctgattgccgaaaagacagtcgtcgagaacgac
ggcgggcttgaccagttcgacgcaatgtgggtctcaagcctctgtgattcgacctcgcgc
ggcaaaccagacattgagctggtcgacctctccgaccgcatccagaccatcaacgaggtc
atggaggtcacaacgaagcccatcatcctcgacatggacacgggcggcacggcggagcat
ttcgcctacaacgtccgcacgctggagcgcatcggagtctctgccgtcatcatcgaggac
aagacgggcgcaaagcgcaactccctcttcggtacagaggtcgcgcagacacaggacacg
atcgagaacttctccgagaagatcgccgcaggcaaggcggcacagcgcacggaggagttc
atgatcatcgcacgcatcgagagcctgatcctcgaaaaggggctggacgacgcgctggaa
cgcgcggagggatacgtcgcggcaggcgcggacggcatcatgatccactcgcgcgcgaag
tctcccgacgaggtcatcgcgttctgcgacgcattccgcgcaaaacatccgaacgtcccg
atcgtcgccgtcccctcctcctacaacacaatcacggaagcggagctcgcggcacacggc
gtgcgcatcgtcatctacgcgaaccaactcacgcgtgcggcattccccgccatggagggc
gcggcacgttccattctcacgcaccaccgcgcacacgagatcgacagtgcgctgctgccg
atcaaggacatcatccggctgatcgaggtagtatag

DBGET integrated database retrieval system