KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C04480Help
Entry
STMDT12_C04480    CDS       T01742                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00330  Arginine and proline metabolism
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01130  Biosynthesis of antibiotics
sem01230  Biosynthesis of amino acids
Module
sem_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    STMDT12_C04480
Enzymes [BR:sem01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     STMDT12_C04480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Sacchrp_dh_NADP Shikimate_DH GFO_IDH_MocA 2-Hacid_dh_C FAD_binding_4 OCD_Mu_crystall PDH ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAJ35391
NITE: STMDT12_C04480
LinkDB All DBs
Position
complement(477301..478110)
Genome map
AA seq 269 aa AA seqDB search
MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAALHDQYGINAAQSAQEV
AQVADIVFGAVKPGIMVKVLSEISSSLNKDSLVVSIAAGVTLDQLARALGHDRKIIRAMP
NTPSLVNAGMTSVTPNALVTPEDTADVLNIFRCFGGAEVIAEPMIHPVVGVSGSSPAYVF
MFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGKHPGELKDMVCSPGGTTIEAV
RVLEERGFRAAVIEAMTKCMEKSEALSKS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaaatcggttttattggctgcggtaatatgggcaaggctattcttggcgga
ctgattgccagcggtcaggtacttcccggccagatctgggtctataccccctcccccgat
aaagtcgccgccctgcatgatcagtacggcattaatgcggcgcaaagcgcgcaggaggtc
gctcaggtcgcggatatcgttttcggcgcggtaaaaccgggcattatggtgaaagtgctc
agtgaaatctcctccagcctgaacaaagactcgctggtggtctctatcgccgcaggcgta
acgcttgatcagcttgcgcgcgcgctgggacacgaccgtaaaatcattcgcgctatgccg
aatacgccgtcgctggtcaacgcaggaatgacctccgtcacgcccaacgcgctggtcaca
ccggaagatacggctgatgtgctgaatattttccgctgctttggcggggcggaagtgatt
gctgagccgatgatccatccggtggttggcgtgagcggatcttcgccggcctatgtcttt
atgtttatcgaggcgatggcggacgctgccgttctgggcggtatgcctcgcgctcaggct
tataaattcgccgcgcaggccgtcatggggtcggcgaaaatggtactcgaaaccggaaag
catcccggcgaactgaaagatatggtgtgctcgcctggcggaacgacgattgaagccgta
cgcgttctggaagaacgtggcttccgcgctgcggtaatagaagcgatgacgaagtgtatg
gaaaaatcagaggcgctcagtaaatcctga

DBGET integrated database retrieval system