KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C06710Help
Entry
STMDT12_C06710    CDS       T01742                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Brite
KEGG Orthology (KO) [BR:sem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STMDT12_C06710
Enzymes [BR:sem01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     STMDT12_C06710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_3 Thi4 Glutaredoxin K_oxygenase AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: BAJ35614
NITE: STMDT12_C06710
LinkDB All DBs
Structure
PDB: 

Position
709307..710872
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPV
RKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAATEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcagggcttaccttgagaaactgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcggaaatcaaggaactgctg
gctgaaatcgccgagctgtccgacaaagtcacgtttaaagaagacaatactctgccggtg
cgcaagccgtctttcctgattacgaatccaggttctcagcaagggccgcgctttgccggt
tctccgctgggccacgaatttacctcgctggttttggcgctgctgtggaccggcggtcat
ccgtcaaaagaagcgcagtcgctgctggagcagattcgcgatattgacggcgattttgaa
ttcgaaacttattattcactctcctgccataactgcccggacgtagtgcaggcgctgaac
ctgatggcggtgctgaacccgcgtattaaacatacggcaattgatggcggcaccttccag
aacgaaatcaccgaacgtaacgtgatgggcgttccggcggtatttgttaacggtaaagag
ttcggccagggacgtatgactctgaccgagattgtcgctaaagtggatactggcgcagaa
aaacgcgcggcggaagcgctgaacaaacgcgatgcgtatgacgtactgattgtcggctcc
ggcccggcgggcgcggcggcggcggtctactcggcgcgcaaaggcatccgtaccggtctg
atgggcgagcgcttcggcggtcaggtgctggataccgtggatatcgaaaactatatctcg
gtgccgaaaaccgaaggccagaaactggcgggcgcgctgaaagcgcatgtcagcgattac
gacgttgacgttatcgacagccagagcgcaagtaaactggttccggccgcaacagaaggc
ggcttgcatcagattgaaacggcgtccggcgcagtattgaaagcgcgtagtatcatcatc
gccaccggcgcgaaatggcgcaatatgaatgtgccgggcgaggatcagtatcgcaccaaa
ggcgtcacctattgtccgcactgcgacggtccgttatttaaagggaagcgtgtggcggtc
atcggcggcggcaactctggcgttgaagcggctatcgatctggcaggtattgtagaacat
gttacgttgctggagttcgcgccggagatgaaggcggatcaggtgctacaggacaaagtg
cgtagtctgaaaaatgtcgatatcattttgaatgcgcaaacgacagaagtgaagggcgac
ggttcgaaagtggtgggactggagtatcgtgaccgtgtcagcggcgatattcatagcgtc
gcgctggcagggatttttgtgcagattggtctgttgccgaatacccactggctggaaggc
gcgcttgagcgtaaccgcatgggcgagatcattattgacgccaaatgtgaaaccagcgtt
aagggcgtcttcgccgcaggcgattgcaccaccgttccttacaaacagattatcatcgcc
acgggcgaaggggcgaaagcctcgttgagcgcctttgattatctgattcgcaccaaaatc
gcataa

DBGET integrated database retrieval system