KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C23050Help
Entry
STMDT12_C23050    CDS       T01742                                 

Gene name
glpA
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00564  Glycerophospholipid metabolism
sem01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    STMDT12_C23050 (glpA)
Enzymes [BR:sem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     STMDT12_C23050 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 DAO_C Thi4 3HCDH_N HI0933_like NAD_binding_8 Lycopene_cycl Pyr_redox_3 FtsA SO_alpha_A3 GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BAJ37248
NITE: STMDT12_C23050
LinkDB All DBs
Position
2385779..2387407
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQTSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDDLAFQATFIRACEAAGIRAEA
IDPQQARIIEPSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGAIVLTAHEVTGLIRE
GATVCGVHVRNHLTGETQTLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDSNRVTADEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCITADTPLPGSKESTEHTLKRIISLPAPLRGSAVYRHGDRTP
GWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSEFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEHQD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaaacaagtgacgtgattatcattggcggtggagcaacaggc
gcagggatcgcccgcgactgcgcgctgcgcggtttacgtgtcattctggtggagcggcat
gatatagcgaccggcgcgaccgggcgtaaccacgggctgctgcacagcggcgctcgttat
gcggttaccgacgcggaatccgcgcgcgagtgcattagtgaaaaccagattttaaaacgg
atcgcccgccattgcgtcgaaccgacggatggtctgtttattacgttgccggaagatgat
cttgcgtttcaggccacctttattcgcgcctgtgaagcggcaggcattcgcgctgaagcc
atcgatccgcagcaggctcgcatcatcgaaccttccgttaaccctgcgctcatcggtgcg
gtaaaagtgccggatggcaccgtggaccctttccgccttaccgccgccaatatgttggat
gccagagaacatggcgcaatcgtgttaacggcgcatgaagtgaccgggctcattcgtgaa
ggcgcaacggtctgcggcgtccatgtgcgcaaccatctcactggcgaaactcagacgctt
cacgcgccggtggtggtcaatgcggcaggtatctgggggcaacggatcgccgaatacgcc
gacctgagtattcgcatgttcccggcgaaaggctcgctgttgatcatggaccatcggatc
aaccagcatgtcattaaccgctgccggaaaccatcggatgccgacattctggtacctggc
gatacgatttcactgatcggcaccacctctacccatattgattacaatgagatagacagc
aaccgcgtcaccgcagatgaagtcgatatcctgctgcgtgaaggggaaaaactggcccct
gtcatggcgaagacgcgtattctgcgcgcgtattccggcgtccgcccgctggtggccagc
gatgacgatcccagcggtcgtaacgtcagccgcggtattgtgttgttcgaccacgccgaa
cgcgacgggcttgatggcttcattaccattaccggcgggaagctaatgacttaccgcctg
atggcggaatgggcgaccgatgccgtgtgccgcaagttgggcaatactcgcccctgcatc
acggcggatacgccgttgcctggctcaaaagagtctacggaacatacgctgaaacgcatt
atctcgcttcccgcgccgctacgcggatcggcggtttatcggcatggcgatcgcacgccg
gggtggctgagtgaaggccgccaacaccgtagcctggtctgtgaatgcgaggccgtcacg
gcgggggaagtgcagtatgccgtcgaaaacttaaccgtgaatagcctgctggatctgcgc
cgtcgcacccgcgtagggatgggcacttgccagggcgaactgtgcgcctgccgcgcggcc
gggctattgcagcgttttaatgtgacgaccgcggcgcaatctattacgcaactctctgaa
tttctgaatgagcgctggaaaggcgtacaacctgtcgcctggggagacgcgctgcgcgaa
agcgaattcacgcgctgggtttatcagggattatgcggtctggagaaggagcaccaggat
gaaatttga

DBGET integrated database retrieval system