KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C24930Help
Entry
STMDT12_C24930    CDS       T01742                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00030  Pentose phosphate pathway
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01120  Microbial metabolism in diverse environments
sem01130  Biosynthesis of antibiotics
sem01200  Carbon metabolism
sem01230  Biosynthesis of amino acids
Module
sem_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sem_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STMDT12_C24930
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    STMDT12_C24930
Enzymes [BR:sem01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     STMDT12_C24930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAJ37436
NITE: STMDT12_C24930
LinkDB All DBs
Position
2578925..2580925
Genome map
AA seq 666 aa AA seqDB search
MSRKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLKHNPTDPTWYDRDRFI
LSNGHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEIGYTPGVETTTGPLGQGLA
NAVGLAIAERTLGAQFNRPDHEIVDHYTYVFMGDGCLMEGISHEVCSLAGTLGLGKLIGF
YDHNGISIDGETEGWFTDDTAKRFEAYHWHVVHDIDGHDPEAVKKAILEAQSVKDKPSLI
ICRTVIGFGSPNKAGKEESHGAALGEEEVALTRQKLGWHHPAFEIPKEIYRAWDGREKGE
KAQQQWQEKFAAYEKAYPELAAEFTRRMSGGLPEAWESATQKFINDLQANPAKIATRKAS
QNTLNAYGPLLPELLGGSADLAPSNLTIWKGSTSLKEDPAGNYIHYGVREFGMTAIANGI
AHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVYTHDSIGLGEDGPTHQAVEQLAS
LRLTPNFSTWRPCDQVEAAVGWKLAIERQHGPTALILSRQNLAQVERTPEQVKAIARGGY
ILKDSGGKPDIILIATGSEMEITLQAAEKLTGEGHNVRVVSLPSTDIFDAQDEAYRESVL
PAHVTARVAVEAGIADYWYKYVGLKGAIIGMTGYGESAPADKLFPYFGFTVENIVEKARR
VLNIKG
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaaagaccttgccaatgcgattcgtgcgctgagcatggatgccgttcaaaaa
gccaattccgggcaccccggcgcgccgatggggatggcggatatcgctgaagtgctatgg
aacgattttcttaaacataaccccaccgatccgacctggtatgaccgtgatcgttttatc
ctttccaacggtcacgcctccatgctgctctatagtctgctgcatttaaccgggtatgac
ctgccgctggaggagttaaaaaacttccgtcaactgcactctaaaacgccaggtcacccg
gagattggctatacgcccggcgttgaaaccaccaccggaccgctgggccaggggctggcg
aatgccgtcgggctggcgattgccgagcgtacgttaggcgcacagttcaaccggccggac
catgagattgtcgaccactacacctatgtctttatgggcgacggctgtctgatggagggg
atctcgcatgaggtgtgttcgctggctggtacgctgggactgggcaaactgatcggcttt
tacgatcacaacggcatctccattgatggcgaaaccgaaggctggtttaccgacgatacc
gccaaacgttttgaagcctaccactggcatgtcgtacatgacattgacgggcacgatccg
gaggcggtgaaaaaagccattctcgaagcccagagcgtaaaagataaaccttcgctaatt
atctgtcggacggtgataggttttggctcgccgaataaagccgggaaggaggagtcgcac
ggcgcggcgctgggcgaagaagaggtggcgctgacccgccagaagctgggatggcatcat
ccggcgtttgagatcccaaaagaaatttaccgcgcgtgggatggccgtgaaaaaggcgag
aaagcgcagcagcagtggcaggaaaagtttgctgcttatgagaaggcttatcctgagctg
gccgcggagtttacccgccggatgagcggcggactgccggaggcatgggaatccgccacg
caaaaatttattaacgacttgcaggctaatccggccaaaatcgccacccgtaaagcatcg
caaaatacgctcaatgcctacggtcccctgttgccggaactgttgggcggatcggcagat
ctggcgccgagcaacctgactatctggaaaggttcgacctcgttgaaagaggatccggca
ggtaattatatccactatggcgtgcgcgaattcggcatgaccgccattgctaacggcatc
gcccaccacggcggctttgtaccgtataccgccacgtttctgatgtttgtcgaatatgcg
cgtaacgcggcgcgtatggcggccttaatgaaagcccggcagattatggtctatacccac
gactccatcggtttgggcgaagatggcccgacgcaccaggccgtggaacaactggcgagc
ctgcgcttaacgcctaacttcagcacctggcgtccctgcgatcaggttgaggcggcagtc
ggctggaagctggccattgaacgtcagcacgggccgacggcgctgattctctcgcggcag
aatctggcgcaggtggaacgcacgccggaacaggtgaaagcgattgcccgcggcggttat
attctgaaagatagcggcggcaagccggatatcattctgatcgctaccggatcggaaatg
gaaattaccctacaggcggcggaaaaattgactggcgaggggcataacgttcgcgtggtg
tcgttgccttcaacggatattttcgatgcgcaggacgaggcatatcgcgaatcagtgcta
ccggcacacgtaaccgcccgcgtcgcggtggaggccggtatagccgactactggtataaa
tatgttggcctaaaaggcgcaattatcggcatgacgggatacggtgaatccgctccggct
gacaaactgttcccgtattttggctttaccgtggaaaatattgtagaaaaagcccgccgg
gtgctaaacatcaaaggctaa

DBGET integrated database retrieval system