KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C26040
Entry
STMDT12_C26040    CDS       T01742                                 

Definition
(GenBank) leucine-rich repeat-containing protein
  KO
K23942  Gifsy-1 prophage leucine-rich repeat protein
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sem00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    STMDT12_C26040
SSDB
Motif
Pfam: FNIP LRR_4
Other DBs
NCBI-ProteinID: BAJ37547
NITE: STMDT12_C26040
LinkDB
Position
2724426..2725895
AA seq 489 aa
MKIGFQPAILQYAYTSNEATSNLELLNKWRIESPDIEKEERNSIYDKIIEANHTGSLSIT
AHHVTSIPVFPDNLSELNLSSCYTLESIPNLPDGLKSLTISGNQTIKISYFPDSLESLSI
DMQAYEENYTFPALPYGLKSFTACYGKFLPPLPPHLSSLSLQNFSEILCAELPYKLDKLD
LQNCPFLPLMKMLPEELKELSIELIRTVPGTVIDDILPDKLKKLSINFCDNIKLPVKLPV
NLKSINLSSRTPIAWEIPTCNLPAHIDISTDGYVKLNPEFLTRSDITFSNKPAGDVLSFQ
PGDVVYGLCKARDRVNTLVNSLYYFSKKDIIIQNTLTDAVWDRKNRAVFNKDEKIAERLN
DVQRGIFFREFLSQHKKYNITEDKYSDLSNEECWIKTSKAGLEFQTRLRERSVIFVIDNL
VDAISDIANKTGKHGNSITAHELRWVYRNRHDDLVKQNVKFFLNGEAISHEDVFSLVGWD
KYKPKNRNR
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgaaaataggattccaaccagccatattgcaatatgcatatacaagtaacgaggcgaca
tcaaaccttgagttattaaataaatggagaatagaatccccagatattgagaaggaggag
cgtaatagtatttacgacaaaataatagaagcaaatcataccgggagcttatcaattact
gctcatcatgttacctctattccggtatttcctgataatttatccgaattgaatttatct
tcatgctatacactggagtctattccaaatcttcctgatgggttaaaaagtttaactata
tctggaaatcagaccattaaaatttcatatttcccagatagcttagagtcactatctata
gatatgcaggcatatgaagaaaattatactttccccgcattaccttatggattaaagagt
tttactgcatgctatggtaaatttttgcctccccttcctccgcatctatcttctttgtca
ttgcaaaatttctctgaaatattatgtgctgagttaccatataaattagataaattagat
ttacaaaattgccctttcttgccattaatgaaaatgttacctgaggagttaaaagaacta
agtattgaacttatacgaacagttcccggtactgttatagatgatattttgcctgataag
ctaaaaaaattaagtatcaacttttgtgataatattaaacttccagttaagcttcctgtt
aatttaaagtctatcaatttatcctcaaggacccctattgcatgggaaataccaacctgc
aatctgcctgcacatatagatattagtaccgatggttatgttaagcttaatcctgaattt
cttaccaggagtgatattacctttagtaacaaacctgcaggagatgtgttaagttttcag
cctggagatgtggtttatggtttatgtaaggcaagagatcgagtaaatactttagttaat
tcgttatattatttttcaaaaaaagatattattattcaaaatacattaacagatgcggtc
tgggacaggaagaatagagccgtgtttaataaagatgagaagatagcagaaagattgaat
gatgttcagagagggattttttttagagaatttttatctcaacataaaaaatacaatatt
accgaagataaatattcagacttatccaatgaggagtgctggataaaaacaagtaaagcc
ggtcttgaatttcaaacacgattgagggaacggtcagttatttttgtcattgacaattta
gttgatgctataagtgatatcgcaaataaaacaggaaagcatggtaattctattacagca
catgagctaagatgggtatatcggaatcgacatgatgatctggtaaaacaaaatgttaaa
ttttttcttaatggtgaggctatttcacacgaagatgttttttcattagttggttgggat
aaatataagcctaaaaatagaaatcgttga

DBGET integrated database retrieval system