KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C42670Help
Entry
STMDT12_C42670    CDS       T01742                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00620  Pyruvate metabolism
sem00680  Methane metabolism
sem01100  Metabolic pathways
sem01120  Microbial metabolism in diverse environments
sem01200  Carbon metabolism
Module
sem_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STMDT12_C42670
  09102 Energy metabolism
   00680 Methane metabolism
    STMDT12_C42670
Enzymes [BR:sem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     STMDT12_C42670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAJ39210
NITE: STMDT12_C42670
LinkDB All DBs
Position
complement(4440342..4442993)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPDLNDA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEINNCLKQLDNTDIADYERHQVMRRLRQ
LIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIHVLVSELSMVDATPELL
ALVGEEGASEPYRYLMKKLRARLMATQSWLEARLKGEKLPKPAGLLTQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGEITRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNDTREVLETCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTVSSLSLYTSAILEANLLPPPEPKDSWRHIMDEL
SVISCETYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAD
YYDQRLVAKTLWPLGKELRDLLEEDIKVVLAIANDSHLMADLPWIAESIQLRNVYTDPLN
VLQAELLYRSRLTEEQGKSPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaggtgctggga
gaaaccatcaaggatgcgctgggagaacacattcttgatcgcgtagaaacaatccgtaag
ctatccaaatcttcacgcgccggcaatgaagctaatcgccaggagctgctcaccacgcta
caaaatttgtctaatgacgagctgctgccagttgcgcgcgcgtttagtcagttcctgaac
ctggccaatactgccgagcaataccacagcatttcgccaaaaggcgaagccgccagcaac
ccggaagtgattgcccgcactctgcgcaaactgaaaaaccaaccggacctcaacgacgca
accatcaaaaaagcggtagagtcgctgtctctggagttggtgctaaccgcccatccgaca
gaaattacccgccgtacgcttattcacaaaatgggtgaaatcaacaactgtctaaaacag
cttgataataccgatatcgccgactacgaacgccaccaggtaatgcgtcgcctgcgccag
ttgattgcccaatcctggcatacggatgagatccgcaagcagcgtccaagcccggtggat
gaagccaaatggggcttcgccgtggttgagaacagcctgtggcagggcgtacctaactat
ctgcgtgaactgaacgaacagctggaagaaaatctcggctacaaattgccggtggatttt
gtgccggtacgttttacctcctggatgggcggcgaccgtgacggcaacccgaacgtgacg
gcggatatcacccgccacgtactcttgttaagccgctggaaagccaccgatctgttcctg
aaagacattcatgttctggtatcagaactgtcgatggtcgacgccacgccggagctgctg
gcgttagtgggcgaagaaggcgcgtctgagccgtatcgctacctgatgaaaaaattgcgc
gcccgtctgatggcgacccagtcctggctggaagcgcgtctgaaaggcgagaagctgccc
aaaccggctggcctgctgacgcaaaacgagcagctctgggaacctctgtacgcctgctac
cagtcgttacaggcctgcggcatgggcattatcgccaacggcgagttactcgacacgctc
cgccgcgtgaagtgtttcggcgtaccgctggtgcgtattgatatccgccaggaaagtacc
cgccatactgaagcgctgggcgaaattacccgctacctcggtattggcgactacgaaagc
tggtcggaagccgacaagcaggccttcctgatccgcgaactgaactccaaacgtccgctg
ctgccgcgtaactgggagccgagcaacgatacccgcgaagtgcttgaaacctgcaaggtt
attgccgaagcgccaaaaggatcgatcgccgcctacgtaatttcaatggcgaaaacgccg
tctgatgtgctggctgtgcatctgctgctgaaagaggcaggtatcggctttgccatgccg
gtcgcgccgctgtttgaaaccctcgatgacctgaacaatgccgacgacgtgatgacccag
ttgttgaatatcgactggtatcgcggactgattcagggtaagcagatggtcatgatcggc
tactccgactcggcgaaagacgccggcgttatggccgcgtcatgggcgcagtatcaggcg
caggacgccctgatcaaaacctgtgaaaaagccggcatcgagcttaccctcttccacggc
cgcggcggatctattggccgtggcggcgcgccagcccacgcggcgctgctttcgcaaccg
ccaggcagtctgaaaggcggtctgcgcgtgaccgagcagggcgagatgatccgcttcaaa
tacggcctgccggaagtcaccgtcagcagcctctcgctctacaccagcgcaattctggaa
gcaaacctgctgccgccgccggaaccgaaagacagctggcgtcatattatggatgagctt
tccgtcatctcctgtgaaacctaccgcggctacgtgcgcgaaaataaagactttgtaccg
tacttccgctccgcgacgccggagcaagagttgggcaaattgccgctcggctcacgtccg
gcgaaacgtcgtccaactggcggcgtcgaatcgctgcgcgcgattccgtggatcttcgcc
tggacgcaaaaccgcctgatgctgccagcctggctgggcgcgggtactgcgctgcaaaaa
gtggtggaagacggtaaacaaagcgaactggaagccatgtgccgcgactggccgttcttc
tccacgcgtcttgggatgctggaaatggtgttctcgaaagccgacctgtggctggccgac
tattacgatcagcgcctggtggcgaaaacgctttggccgctgggcaaagagctacgagac
ctactggaagaagacattaaagtggtgctggcgattgccaacgattcgcacctgatggcc
gacttaccgtggattgcggagtccattcagttaagaaacgtttataccgatccattaaac
gtgttgcaggccgaattgctgtatcgttcccgtctgactgaagagcagggcaaatcgccc
gatcctcgcgtcgaacaggcgttgatggtcacgattgcgggcgtcgctgccggtatgcgc
aacaccggctaa

DBGET integrated database retrieval system