KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C42680Help
Entry
STMDT12_C42680    CDS       T01742                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00220  Arginine biosynthesis
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01130  Biosynthesis of antibiotics
sem01210  2-Oxocarboxylic acid metabolism
sem01230  Biosynthesis of amino acids
Module
sem_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    STMDT12_C42680
Enzymes [BR:sem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     STMDT12_C42680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: BAJ39211
NITE: STMDT12_C42680
LinkDB All DBs
Position
complement(4443362..4444513)
Genome map
AA seq 383 aa AA seqDB search
MKNVLPPFIEIYRALIATPSISATEESLDQSNASLITLLAGWFSDLGFNVEVQPVPGTRN
KFNMLASTGHGAGGLLLTGHTDTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFI
LDALRDVDVTKLKKPLYILATADEETSMAGARYFSKTTALRPDCAIIGEPTSLQPIRAHK
GHISNVVRVLGQSGHSSDPARGVNAIELMHDAIGHIMQLRDSLKARYHYEAFTVPYPTLN
LGHIHGGDASNRICACCELHMDIRPLPGMTLNDLNGLLNDALAPVSERWPGRLTVAELHP
PIPGYECPPDHQLVEVVEKLLGTKTDVVNYCTEAPFMQTLCPTLVLGPGSINQAHQPDEY
LETRFIKPTRELITQVVHHFCWH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgttttaccgccatttatcgagatttaccgcgctttgattgccacaccgtcg
ataagcgcaaccgaagaatccctggatcaaagtaatgcgtctttaatcactttgcttgca
ggctggttcagcgatcttggtttcaacgtagaggttcaaccggttccaggaacgcgaaac
aaatttaatatgctcgccagcaccggacatggcgcgggcggtttgctgctgaccggccat
accgacacggttccctttgatgacggacgctggacgcgcgacccgttcacgctgaccgag
cacgacaataagctctatggtctgggcactgcggatatgaaaggcttcttcgcttttatt
ctggacgcgctacgtgacgttgacgtcacaaagttgaaaaagccgctctacattctggcg
accgccgatgaagagaccagcatggcgggggcgcgttatttttccaaaaccacggcatta
cgtccggactgcgcgatcattggcgaaccgacgtcgttgcaaccgatacgcgcgcacaaa
gggcatatctctaatgtcgttcgcgtcctggggcagtccggtcattccagcgacccggcg
cgtggggttaacgccattgaactgatgcacgatgcgattggccatatcatgcaactgcgt
gactcgctgaaagcgcggtatcactacgaggcgtttaccgttccgtatccaacgctgaat
ctgggccatattcacggcggcgatgcctcaaaccgtatctgcgcctgctgcgaattgcat
atggatattcgtccactgccgggcatgacgttaaacgaccttaatggactgcttaacgac
gcgctggccccggtaagcgaacgctggccgggccgcctgacggtggcggaattacatccg
ccgattccaggttatgagtgtccaccggaccaccaactggttgaagtagtagaaaaactg
ttgggaacgaaaaccgacgtggtgaactactgtactgaagcgccgtttatgcagacatta
tgcccaacgctggtgcttggtccgggctcaattaatcaggcgcatcagccggatgaatat
ctcgaaacgcgttttattaagccaacccgggaattgattacccaggtagtacaccatttt
tgctggcattaa

DBGET integrated database retrieval system