KEGG   Saccharopolyspora erythraea: SACE_0716
Entry
SACE_0716         CDS       T00492                                 

Gene name
eryCIV
Definition
(GenBank) eryCIV NDP-6-deoxyhexose 3,4-dehydratase
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00523  Polyketide sugar unit biosynthesis
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
Module
sen_M00797  dTDP-D-desosamine biosynthesis
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SACE_0716 (eryCIV)
Enzymes [BR:sen01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     SACE_0716 (eryCIV)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 SHMT Beta_elim_lyase Aminotran_5
Other DBs
NCBI-ProteinID: CAM00057
Cambridge: SACE_0716
Kitasato: SACE_0716
UniProt: A4F7N3
LinkDB
Position
complement(781919..783124)
AA seq 401 aa
MKRALTDLAIFGGPEAFLHTLYVGRPTVGDRERFFARLEWALNNNWLTNGGPLVREFEGR
VADLAGVRHCVATCNATVALQLVLRASDVSGEVVMPSMTFAATAHAASWLGLEPVFCDVD
PETGLLDPEHVASLVTPRTGAIIGVHLWGRPAPVEALEKIAAEHQVKLFFDAAHALGCTA
GGRPVGAFGNAEVFSFHATKAVTSFEGGAIVTDDGLLADRIRAMHNFGIAPDKLVTDVGT
NGKMSECAAAMGLTSLDAFAETRVHNRLNHALYSDELRDVRGISVHAFDPGEQNNYQYVI
ISVDSAATGIDRDQLQAILRAEKVVAQPYFSPGCHQMQPYRTEPPLRLENTEQLSDRVLA
LPTGPAVSSEDIRRVCDIIRLAATSGELINAQWDQRTRNGS
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaaacgcgcgctgaccgacctggcgatcttcggcggccccgaggcattcctgcacacc
ctctacgtgggcaggccgaccgtcggggaccgggagcggttcttcgcccgcctggagtgg
gcgctgaacaacaactggctgaccaacggcggaccactggtgcgcgagttcgagggccgg
gtcgccgacctggcgggtgtccgccactgcgtggccacctgcaacgcgacggtcgcgctg
caactggtgctgcgcgcgagcgacgtgtccggcgaggtcgtcatgccttcgatgacgttc
gcggccaccgcgcacgcggcgagctggctggggctggaaccggtgttctgcgacgtggac
cccgagaccggcctgctcgaccccgagcacgtcgcgtcgctggtgacaccgcggacgggc
gcgatcatcggcgtgcacctgtggggcaggcccgctccggtcgaggcgctggagaagatc
gccgccgagcaccaggtcaaactcttcttcgacgccgcgcacgcgctgggctgcaccgcc
ggcgggcggccggtcggcgccttcggcaacgccgaggtgttcagcttccacgccacgaag
gcggtcacctcgttcgagggcggcgccatcgtcaccgacgacgggctgctggccgaccgc
atccgcgccatgcacaacttcgggatcgcaccggacaagctggtgaccgatgtcggcacc
aacggcaagatgagcgagtgcgccgcggcgatgggcctcacctcgctcgacgccttcgcc
gagaccagggtgcacaaccgcctcaaccacgcgctctactccgacgagctccgcgacgtg
cgcggcatatccgtgcacgcgttcgatcctggcgagcagaacaactaccagtacgtgatc
atctcggtggactccgcggccaccggcatcgaccgcgaccagttgcaggcgatcctgcga
gcggagaaggttgtggcacaaccctacttctcccccgggtgccaccagatgcagccgtac
cggaccgagccgccgctgcggctggagaacaccgaacagctctccgaccgggtgctcgcg
ctgcccaccggccccgcggtgtccagcgaggacatccggcgggtgtgcgacatcatccgg
ctcgccgccaccagcggcgagctgatcaacgcgcaatgggaccagaggacgcgcaacggt
tcgtga

DBGET integrated database retrieval system