KEGG   Saccharopolyspora erythraea: SACE_0734
Entry
SACE_0734         CDS       T00492                                 

Gene name
eryCI
Definition
(GenBank) Erythromycin biosynthesis transaminase EryCI
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00523  Polyketide sugar unit biosynthesis
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
Module
sen_M00797  dTDP-D-desosamine biosynthesis
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SACE_0734 (eryCI)
Enzymes [BR:sen01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.106  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase
     SACE_0734 (eryCI)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Cys_Met_Meta_PP AMP-binding Aminotran_5 Beta_elim_lyase
Other DBs
NCBI-ProteinID: CAM00075
Kitasato: SACE_0734
Cambridge: SACE_0734
UniProt: P14290
LinkDB
Position
831725..832825
AA seq 366 aa
MDVPFLDLQAAYLELRSDIDQACRRVLGSGWYLHGPENEAFEAEFAAYCENAHCVTVGSG
CDALELSLLALGVGQGDEVIVPSHTFIATWLAVSRVGAVPVPVEPEGVSHTLDPALVEQA
ITPRTAAILPVHLYGHPADLDALRAIADRHGLALVEDVAQAVGARHRGHRVGAGSNAAAF
SFYPGKNLGALGDGGAVVTTDPALAERIRLLRNYGSKQKYVHEVRGTNARLDELQAAVLR
VKLRHLDDWNARRTTLAQHYQTELKDVPGITLPETHPWADSAWHLFVLRCENRDHLQRHL
TDAGVQTLIHYPTPVHLSPAYADLGLPPGSFPVAESLAGEVLSLPIGPHLSREAADHVIA
TLKAGA
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggacgtccccttcctggacctgcaagccgcgtacctcgaactccggtccgacatcgac
caggcgtgccggcgcgtgctcgggtcgggctggtacctgcacgggccggagaacgaggcg
ttcgaggcggagttcgccgcctactgcgagaacgcgcactgcgtgacggtcggcagcgga
tgcgacgcgctggagctgagcctgctggcgctgggcgtcggtcagggcgacgaggtgatc
gtgccgtcccacaccttcatcgcgacgtggctcgcggtgtcccgcgtgggcgcggtgccg
gtgccagtcgaaccggaaggcgtgagccacacgctcgatccggccctggtggaacaggcc
atcacgccgcggacggccgccatcctgccggtgcacctctacggccaccctgcggacctc
gacgcgctgcgagcgatcgccgaccgccacggcctggcactggtggaggacgtcgcacag
gcggtcggcgcccgccaccgcggccaccgcgtcggcgccggctcgaacgccgcggccttc
agcttctacccgggcaagaacctcggagcgctgggcgacggcggcgcggtcgtcaccacc
gacccggccctggccgagcgcatccgcctgctgcgcaactacggctcgaagcagaagtac
gtgcacgaggtccgcggcaccaacgcccgcctcgacgaactccaggcggcggtcctgcgc
gtcaagctccgccacctcgacgactggaacgcccgccgcacaacgctggcgcagcactac
cagacggaactgaaggacgtccccggcatcacgctcccggaaacccacccctgggccgac
tcagcctggcacctcttcgtcctccgctgcgagaaccgcgaccacctccaacgccacctg
accgacgcgggcgtccagaccctcatccactacccgaccccggtccacctctcacccgcc
tacgccgacctcggcctgcccccaggctccttccccgttgcggagtctctggcgggggag
gtcctcagcctccccatcggcccccacctctccagggaggcggcagaccacgtcatcgcg
accctcaaggctggggcttga

DBGET integrated database retrieval system