KEGG   Saccharopolyspora erythraea: SACE_4141Help
Entry
SACE_4141         CDS       T00492                                 

Definition
(GenBank) type I modular polyketide synthase
Organism
sen  Saccharopolyspora erythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KR PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N adh_short_C2 PKS_DE Epimerase Polysacc_synt_2 GDP_Man_Dehyd SAT RmlD_sub_bind ACP_syn_III NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: CAM03410
Cambridge: SACE_4141
Kitasato: SACE_4141
UniProt: A4FH85
LinkDB All DBs
Position
complement(4598460..4611443)
Genome map
AA seq 4327 aa AA seqDB search
MAGSDEVGIGGAVTAGDEAVAVVGLACRLPGAPDVAAYWRLLRDGVDAVGQAPATRWSAD
GPELPTAVSGDPLRAGFLDQVDRFDAEFFGISPREAALLDPQQRLVLELTWEALEDAGIV
PGGPDDGTGVFIGATSDDYATLRHRSADRATQHTLTGTNRGMIANRVSYAHGLRGPSMTV
DSAQSSSLVAVHLACRSLRDGECSAALAGGVNLNIAPDGYHVVEGFGALSPDGRCYTFDS
RANGYVRGEGGGVVVLKTLSKAIADGDEIYCVIRGSATNNDGPGEGGFTAPSREAQERVL
RQAYRRARIDPASVGFVELHGTGTPVGDPVEAAALGAVLGTARGEGSPLPVGSVKTNIGH
LEGAAGIAGLIKAVLCLRNRELVASLNFEEPDPAIPLPRLGLRVLTGPERPDAGCDPLVA
GVSSFGMGGTNCHVVLSEWSPVRGETDNARPSGELPVVMPVSAATPAALRELAGRLRDHL
AESGARPVDVAYSLATTRAALRHRAVLLPDETGALDGALRSLAQDDVSSNVVRGVPVPGG
VALLLGGQGGQRPGMCRELHAGSRVFAWAFDEICAAMDPHLSRPLRELVFAEPGSAEAAL
LDETEHTQPALFAVEVALFRLAEHWGVAPDVVLGHSVGELAAAHVAGALSLEDACALVAA
RGRLMQALPAGGAMVSVRASEAELAADVVSASGRVSIAAVNGPVSTVIAGDEEPVLAIAD
RWAKRGRKTKRLRVSHAFHSPRMDGMLADFRAAAARVDWRPTRIPVVSNVTGQVLTDDEI
RSPEYWADHARQAVRFADGIRTCTAAGVTTFLELSADGALSALGRDCLDGESADVAFVPL
LRGPERGERRSAMSALARLHVRGVDVDWQAVHDGAARVKLPTYPFQRRRFWLTGSAVDDA
APSAPQARQPLADRIADLPEREQDHAVLELVLRHTAAVLGHDATEAVDQRLSFKELGFGS
LMLVELRDELAEATGRALPATLLFDHPTPAALARGLRAQLTGSAPARPAATEARTPDEPI
AIVAMACRYPGGIRTPEQLWSFVRDGRDAIGEFPVNRGWDLDALHHADPDHAGTSYVRHG
GFLHDADEFDPALFGISPREALAMDPQQRLLLETSWEAFERAGIDPVSLPGSPCGVFVGA
TAHDYGPRMHEAGDGLDGYVLTGTTLSVASGRIAYTFGLEGPAVTVDTACSSSLTALHLA
ARSLRDGECSLALACGVTVMSNPGMFVEFSRQRGLAPDGRCKAFAAAADGTAWAEGAGVL
LLERLSDARRHGHQVLAVLRGSAINQDGASNGLTAPNGLSQQRVICQALAAAGLEPSDVD
AVEAHGTGTSLGDPIEAQALLATYGQERTAPLLLGSVKSNIGHTQAAAGVAGVIKVVMSL
RHGSLPKTLHVDEPSPHVDWSSGAVSLLTEPVPWPRVDRPRRAAVSSFGISGTNAHAIIE
QAPPTEQRDERAAPSMAALAWPLSGGTDSALRERAAQLSAHVDDLPSEAVALACGARASL
PQRAVVVGRRREELLGGLTALGRADAAANVVIGNADISGDTAFVFPGQGGQWQGMALELL
ADSEVFAARLLECAEAVERHVDWSLLGVLRGDPGQPSPDRVDVVQPALFAVMVALASLWR
SYGVEPAAVVGHSQGEIAAACVAGALSLEDAAAVVALRSEALTELSGLGGMLSVPLPQAD
VVSRIDDRVSVAAVNGPESVVLSGEPAALDELLAAFTAEGVRARSIPVDYASHSAQVESI
RERLRTLLAGISPQASRIPFYSTVTGDRIDTRELDAEYWYRNLRHTVRFEAAVSAMASRG
HRFFVEVSPHPLLAVGVQDTLEAAGVGGLATGSLRREQGGLDRFLLSMAEAHVRGMAVDW
SAPFDGSGVVPAELPTYPFQRQRYWLEAPRSASDPSDLGLAPAEHPLLGAATPVAGTGGW
MLTGALSTRTSPWLSDHAVLGAVLLPGTAFLELALHAAGQVGCDLVDELTLHSPLVLPDD
RGVRIQLVVGAPESDGRRSLEIHSRPGDDWTHHASCVLSPCDDTTPASDAAWPPVGAQPV
DVDDRYDRLAEQGYGYGPVFQGLRAAWRRGDEVFAEVVLDEDTSTAARAYVVHPAVLDAA
LHVAGLLPSVPEGTLLPFSFSGARAHSTGASTLRVRLAPVGSACADAAALSLVATDQHGE
LVATVDSLVMRPVSPDRLHTGRHDSLFRLEWVGAEPSAPGEWAVVGPSSLRGLPGCAGHY
QDLAELAETQDQVPPSVLVELDTAGEIADVVRRALALAQEWLAGERFAESRLVLVTRGAV
AAKAGEDVPDLAAAAVWGLLRSAQAENPDRFVLVDTDDHDASLRVLAQLGDAQHAVRAGA
VLVPRLERAPRAAEPSGWDGDGTVLITGAGGTLAGILARHLVAERGVRHLLMVSRRGGSA
PGTTELCEELTGLGAEVTVAACDVADRAALAEVLASIPAERPLTAVVHAAGTLDDGVIES
LTPRRVDHVLRPKVDAALNLAELTRHADLKAFVLFSSVAGVFGSPGQANYAAANAVLDAL
AAQRRARGLPAQSLAWGFWAERSGMTSHLEGADLSRMARGGVVPLSSDEGMTLFETAAAL
DDAVLVAARLDVSALRAQRDALPAVLRGLVPAAPRRSRRTESDGASSLSGRLAEASPADR
EHLVLDLVRTHAAVVLGHANPTSVRPDRPFKEFGFDSLTAVELRNRLNAATGKRLPTTAV
FDHPTPEALARYLLTVLTGTEARTSTPAAVAATTGEPIAIVAMACRYPGGVASPEDLWRL
VSDGGDAISAFPTDRGWPLDGLFDADGDRAGTSYVRAGGFLDDAALFDPALFGISPREAL
AMDPQQRLLLETSWEAFERAGIDPLSVRGTDVGVFAGVMYHDYASRLRQVPEGVEGHLLT
GNTASVASGRVAYTFGLEGPAVTIDTACSSSLVALHLACQALRRGECSMALAGGVTVMAT
PGTFTEFSRQRGLAADGRCKPFAAAADGTGWSEGAGLLLVEPLSLARRNGHPVLALVPGS
AVNQDGASNGLSAPNGVAQQRVIRQALADAGLSTADVDLVEAHGTGTTLGDPIEAQALIE
TYGQGREHPLHLGSVKSNIGHTQAAAGVAGVIKSVMAMRSGTLPRTLHVDQPSPHVDWSA
GAVELLTEARPWPEGGRPRRAAVSAFGISGTNAHVILEQAVEPAPVEPSRRELPVVPWVL
SADSDRALRAQAERLLTHVRDHVDQDAADLGLSLATGRAALAHRAVVLGAGRDELLRSLG
GLAEGREEQGLVRGRADGARGRVAFVFPGQGAQWRGMALELLAESEVFRRRMRECAEAVE
AHVDWKVLDVLRGVDGAPSLDAVEVVQPVSFAVVVSLAELWKSCGVEPAGVIGHSQGEIA
AACVAGALSLADAARVVTLRSAALRELAGSGAMASVALPVEQAEKLLDGHRLSVAAVNGP
SSTVVSGAVPDVEALLADCESRGVRARRIAVDYASHSAHVERIEDELVEVLAPISPRGGD
VTLFSTVTGAEVDTREMDGGYWYQNLRRTVRFQEAVRAAVEAGFDTFVEVSPHPVVAQGI
EETVDAAGREVAVLTTLRRDDGGWERFLTSVAEAHVRGVAVDWRALFAGTGAARVDLPTY
AFQRQRYWLEDAEPTASRVQDPAEAGFWDAVERADLAELSATLDITGDEPFSSVLPSLSA
WHRCRHDLAAVEDWRYRVVWREAPEPSAPASLPGTWLVLVPDAERHQPWVAATVRAMTEC
GARAVTVECGEKDTDRAALADRMGRLLSDQPDVRAVVSLLALDERRHPHHPAVPVGLAAT
LALVQVMSDLDRHTPVWMLTRGAVAAGAERLRRPEQAQIWGLGRVAALEHPRQWGGLVDL
PEDPDDFALRRLCGALAGGLGDEDQLVLRESGALVRRLVRAPVTAAPVRRWRPRGTALVT
GGTGALGPEIARWLAGNGAEHVVLVSRRGADSDGAAELAAELRELGTEVSFEACDVADRD
AVEAMLGRLRAQGREVRSVVHAAALMRLAALADTDLREFADVLAAKVEGARHLAELLDPD
RLDAFVLFSSIAGVWGSGDHGAYAAANAYLDAFAEHLRADGRAITSVAWGVWDGARFPEG
VDAEQLRRQGLPLIAPGPALTALQQVLDHDEAVVSVADVDWDRFVSLFTSARPRPLLDEV
PEAAPAPADDGQDEPGSSWPERLAALGEADQRAALRALVREQAAFVLGHGDGESIDDGRA
FRELGYDSLTAMELRNRLNAATGLRLPATLVFDHPTPAAVAEHLRSRLVRTASGSPVPVF
SELDRIAAAVAAGGVAEDERAEIETRLRALLSAVGAEEVVADADREDLDAATDDEMFELI
EKELGAT
NT seq 12984 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggcagcgatgaggtcgggatcggcggcgcggtgaccgccggggacgaggccgtg
gcggtggtcggcctggcgtgccggctgccgggggcgccggacgtcgccgcgtactggcgg
ctgctgcgcgacggcgtggacgcggtgggccaagcccccgcgacccgctggagcgcggac
ggcccggagctgccgacggcggtctccggtgacccgctgcgcgcgggtttcctcgaccag
gtcgaccgcttcgacgcggagttcttcgggatctcgccgcgggaagcggccctgctcgat
ccgcagcagcggctggtcctcgagctgacgtgggaagccctcgaggacgccgggatcgtc
ccgggcgggccggatgacggcaccggcgtgttcatcggtgccacctcggacgactacgcc
accctccgccaccggtccgcggaccgcgccacgcagcacaccctgaccggcaccaaccgc
ggcatgatcgccaaccgcgtctcctacgcgcacggcttgcgcggtccgagcatgaccgtc
gacagcgcgcagtcgtcgtcgctggtggccgtgcacctggcgtgccggagcctgcgcgac
ggcgaatgttccgcggcactcgccggcggcgtgaacctcaacatcgcgccggacggctac
cacgtggtggagggtttcggcgcgctgtcgccggacgggcgctgctacaccttcgactcc
cgcgcgaacgggtacgtgcgcggtgagggcggcggtgtcgtggtcctcaagacgctgtcg
aaggccatcgccgacggtgacgagatctactgcgtcatccggggcagcgcgaccaacaac
gacggtccgggcgagggcggtttcaccgcgccgagccgcgaagcgcaggaacgggtgctg
cggcaggcctaccggcgggcgcgcatcgacccggcttcggtcggtttcgtcgagttgcac
ggcacaggtacgccggtgggggatccggtcgaagccgccgcgctcggcgcggtcctcggg
acggcccgcggcgagggctcgccgttgccggtggggtcggtcaagaccaacatcggccac
ctggaaggcgctgcgggcatcgccggcctgatcaaggcggtgttgtgcctcagaaatcgg
gaactggtggccagcctgaacttcgaggaacccgatcccgcgatcccgttgccccgcttg
ggactccgggtgctcacgggtccggagcgaccggacgcgggctgcgatccactcgtggcc
ggggtgagctcgttcggcatgggcgggacgaactgccacgtcgtgctgtcggagtggtcg
ccggtgcgcggcgaaaccgacaacgcacgtccgtctggagaactcccggtcgtcatgccc
gtttccgccgctacaccggcggccctgcgcgagctggcgggccggttgcgggaccacctg
gcggagtccggagcacgaccggtcgacgtcgcgtactcgctggccaccactcgtgcggct
ctgcgtcaccgcgcggtgctgctgcccgacgaaaccggggcgctggacggcgcactgcgg
tccctggctcaggacgacgtgagtagcaacgtggtccggggcgtgccggtgccgggcggc
gtggctttgctgctcggcgggcagggcggccagcggccgggcatgtgccgcgagctccac
gcgggctcccgcgtgttcgcgtgggccttcgacgagatctgcgccgcgatggacccgcac
ctgtcccgcccgctgcgtgagctggtcttcgccgagccgggctcggccgaggccgcgctg
ctggacgagaccgagcacacccagccggccctgttcgccgtcgaggtcgcgttgttccgg
ctggccgagcactggggcgtggcacccgacgtcgtgctcgggcactccgtcggcgagctg
gcggccgcgcacgtggccggagcgctgtcgctggaggacgcctgcgccctggtcgcggcc
aggggacggctgatgcaggcgttgcccgccggtggcgcgatggtctcggtgcgggcgagc
gaggccgagctggcggcagatgtggtgtcggcgtccggccgggtgtcgatcgccgcggtg
aacgggccggtgtccaccgtgatcgccggggacgaggagccggtgctcgcgatcgcggat
cgctgggcgaagcgcgggcgcaagaccaaacgcctgcgcgtgagccacgctttccactcg
ccgcggatggacggcatgctggcggacttccgggccgcggccgcgcgagtcgactggcgt
cccacgcgcatccccgtcgtctccaacgtgacgggccaggtgctcaccgacgacgagatc
cgttcacccgagtactgggcggaccacgcgcgccaggccgtgcgtttcgccgacggcatc
cggacctgcacggccgccggtgtcaccacgttcctggagctcagcgcggacggcgcgctg
tcggcactcggacgggactgcctcgacggcgaatccgcggacgtcgctttcgtacccctc
ctgcgcggaccggaacgcggcgagcgtcgttcggcgatgtcggccttggcgcggctgcac
gtgcgcggcgtcgacgtggactggcaggccgtccacgacggcgcggcgcgggtgaagctt
ccgacctaccccttccagcggcgccggttctggctgaccggctccgccgtcgatgacgcg
gcgccatccgcaccgcaagcccggcagccactcgccgaccggatcgcggacctgccggag
cgcgagcaggaccacgctgtgctggagctggtcctccggcacaccgcggcggtactggga
cacgacgcgacggaggcggtcgaccagcggctttcgttcaaggagctcggtttcggctcg
ctgatgctggtggagctgcgcgacgagctcgccgaggcgaccgggagggcactgcccgcg
acgctgctcttcgaccaccccacgccggccgcactggcccgcggtctgcgcgcgcagctc
accggctcggctccggctcgtccggcggccaccgaggcgcgcacaccggacgagccgatc
gcgatcgtggccatggcctgccggtatccgggcggcatccgcacgccggagcagctgtgg
agcttcgtgcgcgacgggcgcgacgcgatcggcgagttcccggtgaaccgcggatgggac
ctcgacgccctgcaccacgccgacccggaccacgcgggcaccagctacgtgcgccacggc
ggtttcctgcacgacgccgacgagttcgacccggcgctgttcggcatcagcccgcgcgag
gcgctggcgatggacccgcagcagcggttgctgctggagacctcgtgggaggcgttcgag
cgggccgggatcgatccggtgtcgttgccgggcagtccgtgcggggtgttcgtcggcgcg
accgcccacgactacgggccgcggatgcacgaggccggcgacgggctcgacggctacgtg
ctgaccggcaccacgcttagcgtggcctccgggcgcatcgcctacaccttcggcctcgaa
gggcccgccgtcaccgtggacaccgcctgctcgtcgtcgctgacggcgctgcacctggcg
gctcggtcgctgcgcgacggggagtgctcgctcgcgctggcctgcggggtcaccgtcatg
tcgaacccgggcatgttcgtggagttcagcaggcagcgggggctggctccggacggccgc
tgcaaggccttcgccgccgcggcggacgggacggcctgggccgagggcgcgggtgtcctg
ctgctggaacggctttccgacgcgcggcggcacgggcatcaggtgctggcggtgctgcgc
ggcagcgcgatcaaccaggacggcgcgtcgaacgggctgacggcgccgaacggcctctcg
cagcaacgggtcatctgccaggcgctggccgccgcgggcctcgaaccgtccgatgtggac
gccgtggaggcgcacgggacgggcacctcgctgggtgatccgatcgaggcccaggcgctg
ctggccacctacgggcaggagcggactgctccgctgctgctgggttcggtcaagtcgaac
atcggccacacccaggcggcggcgggcgtcgccggcgtgatcaaggtcgtcatgtcgctg
cgccacggatcgctgccgaagaccctgcacgtggacgagccctccccgcacgtggactgg
tcgtcgggcgcggtgtcgctgctgaccgagccggtcccgtggccgcgggtggaccgtcct
cgccgagctgcggtgtcctccttcggcatcagcggaaccaacgcgcacgcgatcatcgag
caggcgccgccgacggaacagcgcgacgagcgcgccgcgccgtcgatggcagccctcgcg
tggccgctctccggaggcaccgactcggcgctgcgcgaacgcgccgcccagctctcagcc
cacgtggacgacctgccgtcggaggccgtggcactggcctgcggtgcgcgggcctcgttg
ccgcagcgggccgtcgtcgtcgggcggcgtcgcgaagagctcctcggcggcctgaccgcg
ctggggcgcgcggacgcggccgcgaacgtcgtcatcgggaacgccgacatctcgggcgac
accgcgttcgtcttccccggccagggcggtcagtggcaggggatggcgctggagctgctg
gccgactccgaggtcttcgccgcccgcctgctcgaatgcgccgaggcggtggagcggcac
gtggactggtcgcttctcggcgtgctgcgcggtgatccgggccagccgtcgccggaccgg
gtcgacgtggtgcagcccgcgctgttcgcggtgatggtcgcgctggcctcgctgtggcgc
tcctacggggtcgagcccgccgcggtcgtcgggcacagccagggggagatcgccgccgcc
tgcgtcgcgggagcgctgtccctggaggacgcggcagcggtcgtcgcgctgcgcagcgag
gcgctgaccgagctgtccgggctgggcgggatgctgtcggtgccgctgccgcaggctgat
gtcgtctcgaggatcgatgaccgggtttcggtcgcggcggtcaacggaccggagtcggtg
gtgctctccggcgaacccgcggccctcgacgagctgctggccgcgttcacggccgaaggg
gtccgcgcccggtcgatcccggtcgactacgcgtcgcactccgcgcaggtcgagtccatc
cgcgaacgcctgcgcacgctgctcgcggggatttctccacaggcatcgcggattccgttc
tactcgacggtgaccggcgaccgcatcgacacccgcgaactcgacgccgagtactggtac
cgcaacctgcgccacacggtccgcttcgaagcggcggtcagcgccatggcatcccgggga
caccgcttcttcgtcgaggtcagcccgcatccgctgctggcggtcggggtgcaggacacg
ctggaggccgccggcgtcggcggcctggccaccggctcgctgcgccgcgaacagggcggt
ctcgaccgattcctgctctcgatggccgaagcgcacgtgcggggcatggcggtcgactgg
tccgcgccgttcgacggctcgggcgtggtgcccgccgaactgccgacctacccgttccag
cggcagcgctactggctcgaggcaccccgttcggcatcggatccgtcggacctcgggctg
gcaccggcggagcacccgctgctcggcgcggcgacaccggtcgccgggaccggcggctgg
atgctcacgggggcgttgtcgacccgcacctcgccgtggctttccgaccacgccgtcctg
ggcgcggttctgctgccgggcacggctttcctcgaactggccttgcacgccgctggtcag
gtcggctgcgacctggtcgacgagctgaccctgcacagcccgctggtgctgcccgacgat
cgcggcgtccggatccaactggtcgtcggcgcaccggagtcagacgggcgacggtccctg
gagatccactcgcgacccggggacgactggacgcaccacgcgagctgcgtgctctcgcct
tgcgacgacacgactccggcctcggacgccgcgtggccacctgtcggcgcccagccggtc
gacgtcgacgaccgctacgaccgcctcgcggagcagggctacggctacgggccggtgttc
cagggccttcgtgccgcgtggcgccgcggcgacgaggtcttcgccgaggtggtgctcgac
gaggacacctccaccgcagcccgggcgtacgtggtccacccagcggtgctggacgccgcc
ctgcacgtggcggggctgctgccttcggtcccggaggggacgctgctgccgttcagcttc
agcggtgcgcgagcgcactcgaccggggcttcgacgctgcgggtgcgcctggcgcccgtc
gggtcggcctgcgccgacgccgccgccctctcgctggtcgccaccgaccagcacggcgaa
ctcgtggccactgtggactcccttgtgatgcgcccggtatcgcccgatcggctccacacc
ggtcggcatgactcgctgttccgcctggagtgggtcggcgcggagccctcggcgcccggg
gagtgggctgtcgtcggtccgtcctcgcttcgcggattgccgggatgcgcgggccactac
caggacctcgcggagctggcggagacgcaggaccaggtacccccgtcggtgctggtcgag
ctcgacaccgcgggcgagatcgccgacgtggtgcgccgggccctcgcgctggcgcaggag
tggctggcgggcgagcggttcgccgagtcccggctggtgctggtgacgcgcggggccgtc
gccgcgaaggccggcgaggacgtgcccgatctggccgccgcggcggtgtggggtctgctg
cgctccgcccaggcggagaacccggaccgcttcgtgctggtggacaccgacgaccacgac
gcctcgctgcgcgtgctcgcccagctcggggacgcgcagcacgcggtgcgcgccggtgcc
gtgctggtgccgcgactcgagcgcgcaccgcgagccgcggaaccgtccggttgggacggt
gacggcaccgtcctgatcaccggtgccggcggcacgctcgccggaatcctggcccggcac
ctggtggccgagcgcggtgttcggcacctgctcatggtcagccgccgcggtggatccgcc
ccgggcacgaccgagctgtgcgaggagctgaccggcctgggcgcggaggtgaccgtcgcg
gcctgcgacgtcgccgaccgggccgcgctggcggaagtgctggcctccatacccgcggag
cggccgctgaccgctgtcgtccacgccgcgggcaccctcgacgacggtgtcatcgagtcg
ctgacgccgcggcgcgtggaccacgtgctgcggccgaaggtggacgcggcgctgaacctc
gccgagctcacccgtcacgccgacctgaaggcgttcgtgctgttctcctccgtcgcgggc
gtgttcggcagcccgggccaggcgaactacgccgccgcgaacgccgtgctggacgccctg
gccgcgcagcgccgggcgcgcggcctgcccgcgcagtccctggcgtgggggttctgggcc
gaacgcagcggcatgaccagccatctcgaaggcgcagacctgtccaggatggcccgcggc
ggcgtggtgccgctgtcctcggacgagggcatgacgctgttcgagaccgctgccgcgctc
gacgacgccgtgctcgtcgcggctcgtctggacgtctcggcgctgcgcgcccagcgcgac
gcactaccggcggtgctgcgtggtctggtgccggctgctccccggcgttcccgccgaacg
gagtccgacggcgcgtcctccctgtccggacggctggccgaagcgtccccggccgaccgc
gaacacctcgtgctggatctggtgcggacccacgccgccgtcgtgctggggcacgcgaac
cccacgtcggtgcgaccggacaggccgttcaaggagttcggcttcgactcgctcaccgcg
gtcgaactgcgcaaccgcctcaacgccgccaccggcaagcggctgccgaccactgccgtc
ttcgaccatcccacgccggaggcgttggcgcggtatctgctgacggtgctgaccggcacc
gaggcccggacgtcgacccccgcagcggtcgcggccaccaccggggaacccatcgcgatc
gtggcgatggcctgccggtacccgggcggcgtcgcctcaccggaggacctctggcggctg
gtgtccgacggcggcgacgccatctcggccttccccaccgaccgcggctggccgctggac
ggcctgttcgacgccgacggcgaccgcgcgggcacctcctacgtccgggcgggcggcttc
ctcgacgacgccgccctgttcgacccggcgctgttcggcatcagcccgcgcgaggcgctg
gcgatggacccgcagcagcggttgctgctggagacctcgtgggaggcgttcgagcgggcc
ggcatcgacccgctgtcggtgcgcggcaccgacgtgggcgtgttcgccggcgtgatgtac
cacgactacgcgtcccggctgcgccaggtgcccgaaggcgtcgaaggccacctgctgacc
ggaaacaccgcgagcgtggcctccggtcgcgtcgcctacaccttcggtctggagggaccg
gcggtcaccatcgacaccgcctgctcctcctcgctggtggctctgcacctggcgtgccag
gcgctgcgccgcggcgagtgctcgatggcgctggccggcggcgtgacggtgatggcgaca
ccgggcaccttcacggagttcagcaggcagcgcggcctggccgccgacgggcggtgcaag
ccgttcgccgccgccgccgacggcacgggctggtcggaaggcgccggcctgctgctggtc
gaaccgctgtcgctggcccggcgcaacgggcatccggtgctcgcgctggtgccgggctcg
gcggtcaaccaggacggcgcctccaacggcctcagcgccccgaacggcgtcgcgcagcag
cgcgtcatccgccaggcgctggccgacgcagggctgtcgaccgcggacgtcgacctggtc
gaggcccacggcaccggcaccaccctcggcgacccgatcgaggcccaggcgctcatcgag
acctacgggcagggccgcgaacatccgctgcacctgggatcggtgaagtcgaacatcggg
cacacccaggccgcggcgggtgtcgccggggtgatcaagagcgtcatggccatgcggtcc
gggacactcccgcgaaccctgcacgtcgaccagccgtccccccacgtcgactggtcggcg
ggcgcggtggaactgctcaccgaggcgcgaccgtggcccgagggcggacggccgcgccgg
gcggcggtatcggcgttcggcatcagcggcaccaacgcgcacgtgatcctggaacaggcc
gtggaacccgcaccggtcgagccgtcgcggcgcgagctgccggtggtgccgtgggtgctg
tcggccgacagcgaccgagcactgcgggcgcaggcagagcggctgttgacgcacgtgcgc
gaccacgtggatcaggacgccgcggacctcggtctctcgctggcgaccggccgcgcggca
ctggcgcaccgcgccgtcgtgctgggagccggccgcgacgaactcctgcgctcgctcggc
ggtttggccgagggacgcgaggagcaggggctcgtgcgggggcgggcggacggcgcacgc
ggccgcgtggcgttcgtcttccccggtcagggcgcgcagtggcggggcatggcgctggag
ctgctggccgagtccgaggtcttccggcgccggatgcgcgagtgcgccgaggcagtcgaa
gcccacgtggactggaaggtcctggacgtcctgcgcggtgtcgacggagcgccgtcgctg
gacgcggtcgaggtcgtgcagccggtcagcttcgccgtcgtggtgtcgctggccgagctg
tggaagtcctgcggtgtggagcccgcgggggtgatcggccactcccagggtgagatcgcc
gcggcctgcgtcgcgggcgccctgtcgctggccgacgcggccagggtcgtgaccctgcgc
agcgccgcgttgcgcgagctcgccggcagcggggcgatggcgtcggtggcgctgcccgtc
gagcaggccgagaagctgctggacggccaccggctgtcggtcgctgcggtcaacgggccg
tcgtccacagtggtctccggtgcggtgcccgacgtggaggcgctgctggccgactgcgag
tcgcgcggtgtgcgcgcccgccggatcgcggtcgactacgcctcccactccgcccacgtg
gagcggatcgaggacgaactcgtggaggtgctcgcgccgatctcgccgcgcggcggcgac
gtcacgctcttctcgacggtgacgggcgccgaggtcgacacgcgcgagatggacggcggc
tactggtatcagaacctgcggcggaccgtgcgcttccaggaggcggtccgggcggcggtc
gaggcgggcttcgacaccttcgtcgaggtgagcccgcacccggtcgtggcgcaggggatc
gaggagaccgtcgacgccgccggccgggaggtcgcggtgctgacgacgctgcgccgtgac
gacggcgggtgggaacgcttcctgacttcggtcgccgaagcccacgtgcgaggtgtcgcg
gtggactggcgcgcgctgttcgccggcaccggggcggcgcgggtggacctgcccacctac
gccttccagcggcagcgctactggctggaggacgccgaacccaccgcctcacgggtccag
gacccggcggaggccgggttctgggacgccgtcgaacgcgccgatctcgccgagctgtcg
gccacgttggacatcaccggcgacgagccgttcagcagcgtgctgccgagcctttcggcg
tggcaccggtgccgccacgacctcgccgccgtggaggactggcgctaccgcgtcgtgtgg
cgggaggcgcccgaaccgtcggctcccgcgtcgctgccgggcacgtggctggtcctcgtg
ccggacgccgagcgccaccagccatgggtcgccgcgaccgtgcgcgccatgaccgagtgc
ggtgccagggcggtgaccgtcgagtgcggggagaaggacaccgatcgcgcggcgctcgcc
gaccggatgggacgactgctcagcgaccagcccgacgtgcgcgcggtggtctcgttgctc
gcgctggacgagcgcaggcacccccaccacccggcggtgccggtcggcttggccgccacg
ctggccctggtgcaagtgatgagcgacctcgaccgccacacccctgtatggatgctcacg
cggggcgcggtcgccgcgggagccgaacgtctccgccgcccggaacaggcccagatctgg
ggactgggccgggtggccgccctggaacacccccggcagtggggcggactcgtcgacctg
cccgaagacccggacgacttcgcgttgcggcggctctgcggcgcactggccggcggcttg
ggcgacgaggaccagttggtgctgcgggagagcggagcactcgtgcgcaggctcgtgcgc
gcgcccgtcaccgcagcaccggtgcggcgctggcggcctcgcggcaccgccctggtcacc
ggcggcaccggcgccctcgggccggagatcgcacgctggctggcgggcaacggcgccgag
cacgtcgtgctcgtgagcaggcgcggcgcggactcggacggggccgccgaactcgccgcg
gagctgcgcgaactgggcaccgaggtgagcttcgaggcgtgcgacgtggccgaccgcgac
gcggtcgaggcgatgctaggacgcctgcgcgcccagggacgcgaggtgcgttcggtggtg
cacgcggccgcgctgatgcgcctggccgcgctggccgacaccgacctgcgggagttcgcc
gacgtcctggcggccaaggtcgagggggcccggcacctcgccgaactgctggacccggac
cgcctcgacgccttcgtgctgttctcctccatcgccggggtgtggggcagcggcgaccac
ggtgcctacgcggcggccaacgcctacctggacgccttcgccgagcatctgcgcgccgac
gggcgcgcgatcacgtccgtggcgtggggtgtgtgggacggtgccaggttccccgaaggc
gtcgacgcggaacaactgcgtcgccagggcctgccgctcatcgcgcccggaccggcgttg
acggcgttgcagcaggtgctcgaccacgacgaagcggtggtgtcggtcgccgacgtcgac
tgggaccgcttcgtgtcgctgttcacctccgcccgtccgcgtccgctgctcgacgaggtg
ccggaagcggcgccggcccccgccgacgatgggcaggacgagcccgggtcgtcgtggccg
gaacgactcgcagccctcggtgaagccgaccagcgcgccgcgttgcgggcgctcgtgcgg
gagcaggcggcgttcgtcctcggccacggcgacggggagtcgatcgacgacgggcgcgcg
ttccgcgagctcggctacgactcgctgaccgcgatggaactgcgcaaccggctcaacgcg
gccaccgggctgcggctgccggcgacgctggtgttcgaccacccgacacccgccgccgtc
gccgagcacctgcgttcccggctcgtgcgcactgcatccggatcgccggtaccggtgttc
tcagaactggaccggatcgccgccgcggtggcggccggcggagtcgccgaggacgaacgg
gccgagatcgagacgcggctgcgcgccctgctctcggcggtcggtgcggaagaggtcgtc
gccgatgcggaccgcgaggacctcgacgcggccaccgacgacgagatgttcgagctcatc
gagaaagagctcggcgccacctga

DBGET integrated database retrieval system