KEGG   Saccharopolyspora erythraea: SACE_4163Help
Entry
SACE_4163         CDS       T00492                                 

Gene name
adh1
Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
K00344  NADPH:quinone reductase [EC:1.6.5.5]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00010  Glycolysis / Gluconeogenesis
sen00071  Fatty acid degradation
sen00350  Tyrosine metabolism
sen00625  Chloroalkane and chloroalkene degradation
sen00626  Naphthalene degradation
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_4163 (adh1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SACE_4163 (adh1)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SACE_4163 (adh1)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACE_4163 (adh1)
   00626 Naphthalene degradation
    SACE_4163 (adh1)
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SACE_4163 (adh1)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SACE_4163 (adh1)
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     SACE_4163 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N 3HCDH_N Shikimate_DH ApbA FAD_binding_3 NAD_binding_8 NAD_binding_2 AlaDh_PNT_C NAD_binding_7 Pyr_redox NAD_binding_10 Pyr_redox_2 THF_DHG_CYH_C Methyltransf_25 UDPG_MGDP_dh_N NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: CAM03432
Cambridge: SACE_4163
Kitasato: SACE_4163
UniProt: A4FHA7
LinkDB All DBs
Position
complement(4634534..4635544)
Genome map
AA seq 336 aa AA seqDB search
MRAAIVDRPGSVRVGDVQDPSPGERDVVIKVGACGICGTDLHIADGHFPPTPYPIVPGHE
FAGEVVELGSEAPGGFEIGDRVAVDPSLFCGYCTPCRSGHGNLCANWNATGDTVNGAFAE
YVSVPAATCYRMPDEMTWEQGALVEPVSCAVHGVRQIGVEAGERFLVVGAGTMGLLMQQL
LQRGGAHVTVVDRNTARLGRASRLGAVAVAGDVAELDGERFDAAVDCTGAAPAIEAAFDS
LRRGGRLLVFGVAPAEARVSLSPFRIYNDEITIVGSMAVLHSYGAALDLVASGAVNTEEL
LTDRLTLEDFPKALELMRSGAGLKVQVLPGGVDADA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccgcgatcgttgaccggcccggttcggtccgggtgggcgacgtgcaggacccc
agtccgggggagcgggacgtggtgatcaaggtcggtgcctgcggcatctgcggcacggac
ctgcacatcgccgacgggcacttcccgcccaccccatacccgatcgtgcccgggcacgag
ttcgccggtgaggtggtcgagctcggttccgaggcaccgggtggcttcgagatcggtgac
cgcgtggcggtggacccgtcgctgttctgcggctactgcaccccctgccgctccgggcac
ggcaacctctgcgcgaactggaacgccaccggcgacaccgtcaacggtgcgttcgccgag
tacgtgtcggtacccgccgcgacctgctaccggatgcccgacgagatgacctgggagcag
ggcgcgctggtcgagccggtgtcgtgcgcggtgcacggcgtgcgccagatcggcgtcgaa
gccggcgagcgcttcctggtcgtcggcgcgggcacgatgggcctgctgatgcagcagctg
ctgcagcgcggtggcgcccacgtcacggtcgtcgaccgcaacaccgctcggctgggccgg
gcgagcaggctgggcgcggtggccgtggccggcgacgtcgccgagctggacggcgagcgc
ttcgacgccgcggtggactgcaccggagcggcccccgcgatcgaggcggccttcgactcg
ctgcgccgcggcggccggctgctggtgttcggggtcgccccggccgaggcaagggtgtcg
ctgtcgccgttccgcatctacaacgacgagatcaccatcgtcggctcgatggcggtgctg
cacagctacggcgcggcgctggacctggtggcctccggcgcggtgaacaccgaggagctg
ctcaccgacaggctgacgctggaggacttccccaaggcgctggaactgatgcgcagcggt
gcgggactgaaggtgcaggtgctaccgggaggtgtcgatgccgatgcgtag

DBGET integrated database retrieval system