KEGG   Saccharopolyspora erythraea: SACE_5154Help
Entry
SACE_5154         CDS       T00492                                 

Gene name
bga2
Definition
(GenBank) putative beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SACE_5154 (bga2)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SACE_5154 (bga2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: CAM04398
Cambridge: SACE_5154
Kitasato: SACE_5154
UniProt: A4FK23
LinkDB All DBs
Position
complement(5763008..5765020)
Genome map
AA seq 670 aa AA seqDB search
MTEPQAARRFRERIATIAYGGDYNPEQWPREVWREDIRLMSEAGISLVSVGIFGWALVEP
RPGDFDFGWFDQVLDNLAEGGVAASVATMTASPPPWLARKFPETLPQRADGTILWPGARQ
AYCPSSPVYREHALRLVEKLAERYAQHPALALWHIGNEYGCHVRACYCDSSALAFRDWLR
ERYGDVSELNEAWSTKFWSQRYDDFDEILPPRTAPTFANPAQRLDFARFSSDTMLELLRM
EKAVLRRVTPEIPVTTNHVPLARTLDLHAWSSEVDVVGYDSYPDPHDPRAHVLAGLSYDV
FRSLRGGQPWLLMEQAPNAVNWRPRNAAKAPGQMRLWSWQAVAQGADGVLFFQWRQSAGG
AEKFHSGMVPHAGTDTRTFREVTELGAELAAAGELAGTRPDNDVALVLDWDSWWALELDS
HPSELGQVDALLAHYGPLFDAGIGCDVVHPDRDLSGYRLVVVPNLYLLRETTAANLTDHV
RRGGHLLVSFFSGIVDENDRVHLGGYPAPLREVLGLRIPEFQPLAEGAGIGVELLGSAAR
ATLWSEKIEPKGASVLGTFTEGALAGHPALTRHAFGDGAAWYLATRPEPEAMRTLIDRVT
AEAGVQPVLADLPAGVQATRRGEFFFLLNHNAVEVKVRLPWPAADLLTGAQAAEVTLPPR
GVAVLKPVER
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaaccgcaggccgcccgccgattccgggagcgcatcgccaccatcgcctacgga
ggggactacaaccccgagcagtggccgcgggaggtgtggcgcgaagacatccgattgatg
agcgaggccgggatttccctggtgtcggtgggcatcttcggctgggcgctggtggaaccg
cggcccggcgacttcgacttcggctggttcgaccaggtgctggacaacctcgccgagggc
ggtgtcgcggcttcggtcgcgacgatgaccgcctcgccgccgccgtggctcgcgaggaag
ttcccggaaacgctgccgcaacgcgccgacggcaccatcctgtggccgggcgcccggcag
gcgtactgcccgtccagcccggtctaccgcgagcacgcgctgcggctcgtcgagaaactc
gccgaacgctacgcccagcacccagcgctggcgttgtggcacatcggcaacgagtacggc
tgccacgtccgcgcctgctactgcgacagctcggcgctggccttccgcgactggctgcgc
gagcgctacggcgacgtctccgagctcaacgaggcgtggtcgacgaagttctggtcccag
cgctacgacgacttcgacgagatcctgccgccgcgcaccgcgccgaccttcgccaacccg
gcgcaacggctggacttcgcccgcttctcctcggacaccatgctggagctgctgcggatg
gagaaggcggtcctgcgccgcgtcacgccggagatcccggtgaccaccaaccacgttccg
ctggccaggaccctggacctgcacgcgtggtcgtccgaagtggacgtcgtcggctacgac
tcctaccccgacccgcacgacccgcgcgcccacgtgctggccggcctgtcctacgacgtg
ttccggtcgctgcgcggcggccagccgtggctgctgatggaacaggcgcccaacgcggtg
aactggcggccacgcaacgccgccaaggcccccggccagatgcggctgtggagctggcag
gccgtcgcccagggcgccgacggcgtgctgttcttccagtggcggcagtcggcgggcggc
gcggagaagttccactccgggatggtgccgcacgccggcaccgacacccgcaccttccgc
gaggtcaccgaactgggcgccgaactggccgccgccggggagctggcgggcacccgcccg
gacaacgacgtcgcgctcgtcctcgactgggacagctggtgggccctcgaactggactcc
cacccgtcggagctgggccaggtcgacgcgttgctcgcccactacggcccgctgttcgat
gccggcatcggatgcgacgtcgtgcaccccgaccgcgacctgtccggctaccggctcgtg
gtggtgccgaacctctacctgctgcgggagacgaccgcggcgaacctcaccgaccacgtc
cggcgcggcgggcacctgctggtgtcgttcttctccggcatcgtcgacgagaacgaccgc
gtgcacctcggcggctacccggccccgctgcgcgaggtgctgggactgcggatcccggag
ttccagccgctcgccgaaggcgccggcatcggcgtggaactgctcggcagcgccgcccgc
gcgacgctgtggtcggaaaagatcgagcccaagggtgcgagcgtgctcggcacgttcacc
gagggcgcgctcgccgggcacccggcgctgacccgccacgccttcggcgacggcgcggcc
tggtacctggcaacccgcccggagccggaggcgatgcgcacgctgatcgaccgcgtgacg
gcggaagccggtgtccaaccggtgctggcggacctgcccgccggagtgcaggcgacccgc
cgaggcgagttcttcttcctgctcaaccacaacgcggtcgaggtgaaggtgcggctgccg
tggcccgcggccgacctgctcaccggcgcacaggccgccgaggtcaccctgcccccgcgc
ggagtcgccgtcctcaagcccgtggagcggtga

DBGET integrated database retrieval system