KEGG   Saccharopolyspora erythraea: SACE_5159Help
Entry
SACE_5159         CDS       T00492                                 

Gene name
nanH
Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00511  Other glycan degradation
sen00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SACE_5159 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SACE_5159 (nanH)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SACE_5159 (nanH)
Bacterial toxins [BR:sen02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SACE_5159 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR_3 BNR Laminin_G_2 Laminin_G_1
Motif
Other DBs
NCBI-ProteinID: CAM04403
Cambridge: SACE_5159
Kitasato: SACE_5159
UniProt: A4FK28
LinkDB All DBs
Position
5769332..5771182
Genome map
AA seq 616 aa AA seqDB search
MLAAAVVTVTASSVLAAPAHAAGPPGGPADFTEQALYARGLAGYACYRIPAIVRTTAATL
LAFAEARRNDCGDDGDVDLVVRRSTDGGRTWGPVQLVGDNGPHTFGNPVPVVDAATGRVV
LVTTHNPGDVDRDRTVHVQHSDDDGRTWSAPRDITAQVKDPAWDRWYATGPMHGIQLTRG
EHAGRLVVGASHESADERQVGGHLVYSDDGGLNWRVGANAEHRPDTIKPQEMSVVELVDG
RVYAAARDQGGTDPGHRAFAVSADGGETFEKPFRTIPELQTPIIQGSALRWRAVDEGDAG
NRILFSAPAHPAGREAMSIRSSYDEGGSWESWQDGKIVHWGPSGYSDLTAIDEDTIGLLY
ERGKGNPYEEIVLARFGEAYLEQPNGTPPNFPEPPAPGPTTPDVSKNAHTAYVRGTPGLT
EGRFGSALAATGGQHVHVPLTDELDLRSDDFTVTAWFSYDQTAGAHTLLWAYRMGSENTP
QLWLRAEPGSNRIRAHLAAEEGHATIASTSAFNDGRWHHVVLQRGGGRFRMIVDGAEVAV
AAAPLGSVSAGGAEFGIDGVHIGQRVDGADRWHGALDEVRVYRRALPRGQLDAIRAVNRP
IGAGLELRLPLDGVGR
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgctgcggccgtcgtgaccgtgaccgcgagcagcgtcctggccgcacccgcccac
gccgccggcccacccggcggtccggcggacttcaccgaacaggcgctctacgcccgggga
ctggccggttacgcctgctaccggatcccggccatcgtccggacgaccgccgccaccctg
ctggccttcgcggaggcacggcgcaacgactgcggcgacgacggtgacgtggacctggtc
gtgcggcgctccaccgacgggggccggacctggggcccggtccagctcgtcggcgacaac
ggaccccacaccttcggcaacccggttccggtcgtggacgccgctaccggccgcgtcgtc
ctggtcaccacgcacaaccccggcgacgtcgaccgcgaccgcaccgtccacgtccagcac
agcgacgacgacggccggacctggagcgcgccccgggacatcaccgcgcaggtcaaggac
cctgcgtgggaccgctggtacgcgaccgggccgatgcacggcatccagctcacccgcggc
gagcacgccggacggctcgtggtcggcgcatcgcacgagtcggccgacgagcgccaggtc
ggcggtcacctcgtctacagcgacgacggtgggctcaactggcgggtgggcgccaacgcc
gagcaccggcccgacaccatcaagccgcaggagatgagcgtggtggagctggtcgacggc
cgcgtgtacgccgcggcgcgcgaccagggcggcaccgatcccgggcaccgcgccttcgcc
gtctccgccgacggcggcgagacgttcgagaagccgttccgcacgatccccgagctccag
acgccgatcatccagggctcggcgctgcgctggcgggccgtcgacgagggcgacgcaggc
aaccgcatcctgttctccgcacccgcccacccggccgggcgcgaggccatgagcatccgc
tcgtcctacgacgagggcgggagctgggagagctggcaggacggcaagatcgtccactgg
ggaccgtccgggtactccgacctcaccgcgatcgacgaggacacgatcggactgctctac
gagcgcggcaagggaaatccgtacgaggagatcgtgctcgcgcgcttcggcgaggcgtac
ctggagcagcccaacggcacaccgccgaacttcccggagccgcccgcgccgggtccgacg
actccggacgtgtcgaagaacgcgcacacggcgtacgtgcgaggaacgcccggcctgacc
gagggccggttcggatccgcgttggcggccaccggcgggcagcacgtgcacgtcccgctc
accgacgagctcgacctgcgctccgacgacttcaccgtcacggcgtggttctcctacgac
cagaccgccggagcgcacaccctcctctgggcctaccggatgggttcggagaacaccccg
cagctgtggctgcgcgccgagccggggagcaaccgcatccgcgcgcacctggcggccgag
gaggggcacgccaccatcgcctcgacgtcggcgttcaacgacgggcgctggcaccacgtg
gtcctgcagcgcggcggcgggcggttccggatgatcgtcgacggtgccgaggtcgccgtc
gcggcggctccgctcggctcggtgtcggccggcggcgcggagttcgggatcgacggcgtc
cacatcggacagcgggtggacggtgccgaccgctggcacggcgcgctggacgaggtccga
gtctaccggcgggcgctgccgcggggccagctcgacgcgatccgggcggtgaaccgcccg
atcggcgcgggcctggaactgcggctgccgctggacggggtgggccgatga

DBGET integrated database retrieval system