KEGG   Saccharopolyspora erythraea: SACE_6419Help
Entry
SACE_6419         CDS       T00492                                 

Gene name
sodN
Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sen  Saccharopolyspora erythraea
Brite
KEGG Orthology (KO) [BR:sen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SACE_6419 (sodN)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SACE_6419 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: CAM05589
Cambridge: SACE_6419
Kitasato: SACE_6419
UniProt: A4FNG4
LinkDB All DBs
Position
7195686..7196093
Genome map
AA seq 135 aa AA seqDB search
MRLLSRILSPRLEATAHCDLPCGVYDPAQARIEAESVKAIQEKYQANEDQEFRTRAILIA
EQRSELVKHHLWVLWTDYFKPPHFEKYPQLHELVNKATKAAGATGTKGSMDPAKGQELLD
YIAEIDKIFWETKQG
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcggctactgtcgcgaatcctcagcccgcgtcttgaggcgaccgcgcactgcgatctg
ccgtgcggcgtttacgacccggctcaggcccggatcgaggctgagtccgtaaaggctatc
caggagaagtaccaggccaacgaggaccaggagttccgcacccgcgcgatcctgatcgcc
gagcagcggtccgagctggtcaagcaccacctgtgggtgctgtggacggactacttcaag
ccgccgcacttcgagaagtacccgcagctgcacgaactggtcaacaaggccaccaaggcc
gccggcgccaccggcaccaagggttcgatggacccggccaagggccaggagctgctggac
tacatcgccgagatcgacaagatcttctgggagaccaagcagggctga

DBGET integrated database retrieval system