KEGG   Saccharopolyspora erythraea: SACE_6636Help
Entry
SACE_6636         CDS       T00492                                 

Gene name
icd-2
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00020  Citrate cycle (TCA cycle)
sen00480  Glutathione metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01200  Carbon metabolism
sen01210  2-Oxocarboxylic acid metabolism
sen01230  Biosynthesis of amino acids
Module
sen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sen_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SACE_6636 (icd-2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SACE_6636 (icd-2)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SACE_6636 (icd-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CAM05802
Cambridge: SACE_6636
Kitasato: SACE_6636
UniProt: A4FP27
LinkDB All DBs
Position
complement(7430679..7431899)
Genome map
AA seq 406 aa AA seqDB search
MSKIKVQGTIAELDGDEMTRIIWQFIKDKLIHPYLDVNLDYYDLGIEHRDATDDQVTVDA
ANAIKKYGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIVISNIPRY
VPTWTKPIVIGRHAHGDQYKATDFKVPGPGTVTVTYTPEDGGEPIEFEVAKFGEDGGVAM
AMYNYRRSIEEFARASFRYGLERGYPVYMSTKNTILKAYDGLFKDVFQEVFDNEYKADFD
AKGLTYEHRLIDDMVATAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTEDG
KVEAEAAHGTVTRHFRQHQQGKPTSTNPIASIFAWTRGLQHRGKLDSTPEVVGFAETLEK
VVIETVESGRMTKDLALLVGGDQGYQTTEEFLATLDDNLQKRMANR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcaaggtccagggcaccatcgccgagctcgacggcgacgagatgacgcgg
atcatctggcagttcatcaaggacaagctgatccacccctacctggacgtcaacctcgac
tactacgacctcggcatcgagcaccgggacgccaccgacgaccaggtcaccgtcgacgcc
gcgaacgccatcaagaagtacggcgtgggcgtgaagtgcgccaccatcaccccggacgag
gcccgcgtggaggagttcggcctgaagaagatgtggcggagcccgaacgggacgatccgc
aacatcctcggtggcgtcatcttccgcgagccgatcgtcatctccaacatcccgcgctac
gtaccgacgtggaccaagccgatcgtcatcggccgccacgcgcacggcgaccagtacaag
gcgaccgacttcaaggtgccgggcccgggcacggtgaccgtcacctacacgccggaggac
ggcggcgaaccgatcgagttcgaggtcgccaagttcggtgaggacggcggcgtggcgatg
gccatgtacaactacaggcgctccatcgaggagttcgcccgcgcgtccttccgctacggc
ctcgagcgcggctacccggtgtacatgtccaccaagaacacgatcctcaaggcctacgac
ggcctgttcaaggacgtgttccaggaggtcttcgacaacgagtacaaggccgacttcgac
gccaagggcctgacctacgagcaccggctgatcgacgacatggtcgccaccgccatgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtcgcgcagggcttcggctcgctgggcctgatgacctcggtgctgatgaccgaggacggc
aaggtcgaggccgaggccgcgcacggcacggtcacccggcacttccgccagcaccagcag
ggcaagccgacctcgaccaacccgatcgcgtcgatcttcgcgtggacccgcggcctgcag
caccgcggcaagctggactcgacccccgaggtcgtcggcttcgccgagacgctggagaag
gtcgtcatcgagaccgtcgagagcggccggatgaccaaggacctggcgctgctggtcggc
ggcgaccagggctaccagaccaccgaggagttcctcgcgacgctggacgacaacctgcag
aagaggatggccaaccgctga

DBGET integrated database retrieval system