KEGG   Saccharopolyspora erythraea: SACE_7096Help
Entry
SACE_7096         CDS       T00492                                 

Gene name
pstB
Definition
(GenBank) putative phosphate transport ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sen00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SACE_7096 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sen02000]
    SACE_7096 (pstB)
Enzymes [BR:sen01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     SACE_7096 (pstB)
Transporters [BR:sen02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    SACE_7096 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 AAA_16 AAA_30 RsgA_GTPase Rad17 AAA_15 AAA_33 AAA_23 AAA_18 AAA_25 AAA AAA_28 AAA_5 PRK AAA_27
Motif
Other DBs
NCBI-ProteinID: CAM06255
Cambridge: SACE_7096
Kitasato: SACE_7096
UniProt: A4FQD0
LinkDB All DBs
Position
complement(7903596..7904372)
Genome map
AA seq 258 aa AA seqDB search
MAKRLDIKDLNLFYGKFHAVQDVTLQVPARSVTAFIGPSGCGKSTVLRSLNRMHEVIPGA
RVDGKVLLDGEDIYDGKVDPVQVRRTIGMVFQRANPFPTMSIRDNVVAGLKLSGEKNKKH
LDEVTERALRGANLWEEVKDRLAKPGGGLSGGQQQRLCIARAIAVKPDVLLMDEPCSALD
PISTLAIEDLIAELKQEYTIVIVTHNMQQAARVSDQTAFFNLRAVGQPGELVEIDETGKI
FSNPNQKATEDYISGRFG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgtctcgacatcaaggacctgaacctgttctacggcaagttccacgccgtg
caggacgtgacgttgcaggtgcccgcccgcagcgtcaccgcgttcatcggcccgtcgggt
tgcggcaagtccacggtgctgcgctcgctgaaccggatgcacgaggtcatccccggcgcg
cgcgtcgacggcaaggtcctcctcgacggcgaggacatctacgacggcaaggtcgacccg
gtgcaggtgcgccggacgatcggcatggtgttccagcgggcgaacccgttcccgacgatg
tcgatcagggacaacgtcgtggccgggctgaagctgtcgggtgagaagaacaagaagcac
ctcgacgaggtcaccgagcgcgccctgcgcggcgcgaacctgtgggaagaggtcaaggac
cggctcgccaagccgggcggcggcctctccggcggtcagcagcagcggctctgcatcgcg
cgggccatcgcggtcaagccggacgtgctgctgatggacgagccctgctcggcgctcgac
ccgatctcgacgctcgcgatcgaggatctgatcgccgagctcaagcaggagtacacgatc
gtcatcgtcacccacaacatgcagcaggccgcccgcgtcagcgaccagacggccttcttc
aacctgcgtgccgtcggccagcccggcgaactggtggagatcgacgaaaccggcaagatc
ttctccaacccgaaccagaaggcgaccgaggactacatctcgggtcggttcggttaa

DBGET integrated database retrieval system