KEGG   Saccharopolyspora erythraea: SACE_7136Help
Entry
SACE_7136         CDS       T00492                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00500  Starch and sucrose metabolism
sen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SACE_7136
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SACE_7136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: CAM06294
Cambridge: SACE_7136
Kitasato: SACE_7136
UniProt: A4FQG9
LinkDB All DBs
Position
7936712..7938871
Genome map
AA seq 719 aa AA seqDB search
MTDAPGGRGAQDTDRAGARADPAEPDVGPDEHGPDLAELGADLAEPGADLGVAGALHGDE
VADPGGPSAAPGGADGVASTTGGSPSADAHPDDLDTDRGGPGLIEDYALLSDLRTAALVG
RDGSVDWLCLPRFDWPSCFARLLGADHDGHWQIAPVAPVRRVERRYRENSLVLETDFHTD
NGVVRVVDSMPPHEKNHDDQPCLVRMVEGVSGEVAVRMRWVVRFAYGDTTPWVRRVRETD
PVLDEYILAVAGPHTVVLRGDDLPRRVPHQRAHEAVCTVRAGERKSWVMQWSPDPDELPA
PMDPEQETRDSEDFWRTWTRKITYCGPHRDAVYRSLATLKALTYAPTGGIVAAPTASLPE
TLGGDRNWDYRFCWLRDATFVLLALDNFGCQMEAGDWRRWLVRATAGDPRELQIMYGVGG
ERHLLEWEADWLPGYQGAAPVRIGNAAHRQRQLDVYGEVMDALHLARERGLTETPESWAV
QRGMMRHLEQIWRAPDRGLWEVRGPERYFTHSQVMVWVAFDRAVRAIEEDGLPGPLDRWR
GIRDTVRAEVLEHGWNDDVGAFTQYYGGRTLDAATLLLPAVGFLPADDERMRSTVRAIQR
ELQPGGLLVERYSTSDDTSVVGVDGLTGREGAFLACSFWLVDALALGGRRDEAEEMFSKL
VALANDVGLYAEEYDVRSGRFVGNFPQAFTHVALVNSAAVLYGGHARHEASRRDGRGDR
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgctcccggtggacgaggcgctcaggacaccgaccgggccggagcacgagca
gatccggccgaacccgatgtcggcccggacgaacacggcccggacctggcagagctcggg
gccgacctcgccgagccgggtgcggacctgggtgtggcgggcgccctgcacggcgacgag
gtcgccgatcccgggggacccagcgccgcgccgggcggcgctgacggcgtcgcaagcacc
accggcgggtcaccgtcggccgatgcgcatcccgacgatctggacaccgatcgcggcggt
ccggggctgatcgaggactacgcgctcctgtcggacctgcggaccgccgccctcgtcggc
agggacggctcggtcgactggctgtgcctgccccgcttcgactggccgtcgtgcttcgcc
cggctgctgggcgccgaccacgacgggcactggcagatcgcccccgtcgcgccggtgcgc
cgcgtggaacgcaggtaccgggagaactccctggtgctggagaccgacttccacaccgac
aacggggtcgtgcgggtcgtcgacagcatgccgccgcacgagaagaaccacgacgaccag
ccgtgcctggtgcggatggtcgagggcgtctccggcgaggtcgcggtccggatgcgctgg
gtcgtgcgcttcgcctacggcgacacgacgccgtgggtgcggcgggtacgggagaccgac
ccggtgctcgacgagtacatcctcgccgtcgccggcccgcacacggtggtactgcgcggc
gacgacctgcccaggcgggtgccgcaccagcgggcgcacgaggcggtctgcaccgtgcgt
gccggcgagcggaagtcgtgggtgatgcagtggtcccccgacccggacgagctgcccgcg
ccgatggaccccgaacaggagacccgcgacagcgaggacttctggcggacgtggacccgc
aagatcacctactgcggtccgcaccgagacgcggtttaccggtcgctggccacgctcaaa
gcgctgacctacgcgccgaccggcgggatcgtcgccgccccgaccgcgtcgctgccggag
acgctgggcggtgaccgcaactgggactaccgcttctgctggcttcgcgacgcgacgttc
gtgctgctggcgctggacaacttcggctgccagatggaagccggggactggcggcggtgg
ctcgtgcgggcgaccgcgggcgacccccgcgagctgcagatcatgtacggcgtcggcggt
gagcggcatctgctggagtgggaggcggactggctgcccggctaccagggcgccgcgccg
gttcggatcggcaacgccgcgcaccggcagcgccagctcgacgtctacggcgaggtgatg
gacgcgctgcacctggccagggagcgcggcctgaccgagacgccggagtcgtgggcggtg
cagcgcggcatgatgcgccacctggaacagatctggcgcgcgcccgaccgcggactgtgg
gaggtgcgcggtccggagcggtacttcacgcactcgcaggtgatggtgtgggtggccttc
gaccgcgcggtgcgcgccatcgaggaggacgggctgccggggccgctggaccgctggcgc
ggcatccgcgacaccgtgcgcgcggaggtgctggagcacggctggaacgacgatgtcggc
gcgttcacgcagtactacggcggccggacgctggacgcggcgacgctgctgctgcccgcc
gtcgggttcctgcccgccgacgacgagcggatgcggagcacggtgcgcgcgatccagcgc
gagttgcagcccggcgggctgctcgtcgagcgctacagcacctcggacgacaccagcgtc
gtgggggtcgacgggctgaccggccgcgagggcgcgttcctggcgtgctcgttctggctg
gtggacgcgctggcgctgggcggacggcgcgacgaggccgaggagatgttctccaagctg
gtcgcgctggccaacgacgtcgggctctacgcagaggagtacgacgtgcgcagcgggcgg
ttcgtcggcaacttcccgcaggcgttcacccacgtcgcgctggtcaactcggcggcggtg
ctctacggcgggcacgcacggcacgaagccagcaggcgcgacggccgcggcgaccgctag

DBGET integrated database retrieval system