KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090135: AU38_00610Help
Entry
AU38_00610        CDS       T03731                                 

Definition
(GenBank) cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
sena  Salmonella enterica subsp. enterica serovar Enteritidis EC20090135
Pathway
sena00550  Peptidoglycan biosynthesis
sena01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sena00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AU38_00610
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01501 beta-Lactam resistance
    AU38_00610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sena01011]
    AU38_00610
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sena03036]
    AU38_00610
Enzymes [BR:sena01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AU38_00610
Peptidoglycan biosynthesis and degradation proteins [BR:sena01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AU38_00610
Chromosome and associated proteins [BR:sena03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    AU38_00610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AHP68134
LinkDB All DBs
Position
141412..143178
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWLQIIAPDMLVRQGDMR
SLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALSTALNIP
LDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLAGTPKDAMRNRTIT
DVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERIFPESTVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggcaaaaacgcaaaaatcgaaacgccaggaagaacagaccaacttcatc
agttggcgttttgcgttgctgtgcggctgtattttactggcgctggtttttttacttgga
cgcgcggcgtggctacagattatcgccccggatatgctggtgcgtcagggcgatatgcgt
tcgctgcgtgttcaggaagtctccacctcacgcggtatgattaccgaccgttccgggcgt
ccactggcggtcagcgtaccggttaaggcgatctgggccgacccgaaagaagttcatgac
gccggcggcatcagcgttggcgatcgctggaaagcgctttctactgcgctcaatattccg
ctcgatcagctctccgcccgtatcaacgccaacccgaaagggcgttttatttatctggcg
cgccaggtaaatcctgacatggcggactacatcaaaaaactcaaactgccggggattcat
ttgcgtgaagagtcccgccgctactacccgtcaggagaagtaaccgctcacctcatcggt
tttaccaacgtcgacagtcagggtattgaaggcgttgaaaagagctttgataagtggctt
accggtcagcctggcgagcgaatcgtgcgtaaagaccgctatggccgcgtgattgaagat
atctcctccactgatagtcaggcagcgcacaacctggcgttaagcattgatgaacgctta
caggcgctggtttaccgcgaactgaacaacgcggtggcgtttaacaaggcggaatccggt
agcgcggtgctggtcgatgtcaataccggtgaagtactggcgatggcgaatagcccttcc
tataaccccaacaaccttgccggtacgccgaaagacgcgatgcgtaaccgtaccatcacc
gacgtgtttgaaccaggttctacggttaagccgatggtggtgatgactgcgcttcagcgc
ggtatcgtcaacgaaaatacggtgttgaataccgttccataccgaattaacggccacgaa
attaaagacgtggcgcgctacagcgaattaaccctgaccggggttctacagaagtcgagt
aacgtcggtgtatccaagctggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttgggctaggaaaggcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtccgacatagagagggccaccttctctttcggctacggg
ctaatggtaacgccgttacaattagcgcgagtctatgcaacgatcggcagctatggcatt
tatcgcccgctgtcgattaccaaagttgatccgcctgtacccggcgaacgcatcttccct
gaatccaccgtacgcaccgtggtgcatatgatggaaagcgtggcgctgccgggcggcggc
ggcgtgaaggcggcgattaaaggctaccgtatcgcgattaaaaccggtacggcgaaaaaa
gtggggccggacggtcgctacatcaacaaatacattgcttataccgcaggcgtcgcgcct
gcgagtcagccgcgcttcgcgctggtggttgtcatcaacgatccgcaggcgggtaaatac
tacggcggcgccgtttccgcgccggtatttggtgccatcatgggcggcgttctgcgcacc
atgaacatcgaaccggacgcgctggcaacgggcgaaaaaaatgaattcgtaattaatcaa
ggcgagggaacaggtggcagatcgtaa

DBGET integrated database retrieval system