KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090135: AU38_09585Help
Entry
AU38_09585        CDS       T03731                                 

Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
sena  Salmonella enterica subsp. enterica serovar Enteritidis EC20090135
Pathway
sena00061  Fatty acid biosynthesis
sena00780  Biotin metabolism
sena01100  Metabolic pathways
sena01212  Fatty acid metabolism
Module
sena_M00083  Fatty acid biosynthesis, elongation
sena_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:sena00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AU38_09585
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AU38_09585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sena01004]
    AU38_09585
Enzymes [BR:sena01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     AU38_09585
Lipid biosynthesis proteins [BR:sena01004]
 Fatty acid synthase
  Component type
   AU38_09585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AHP69827
LinkDB All DBs
Position
complement(1957026..1958267)
Genome map
AA seq 413 aa AA seqDB search
MSKRRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCD
DIISRKEQRKMDAFIQYGIVAGVQAMQDSGLEVTEENASRIGAAIGSGIGGLGLIEENHS
SLVKGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAY
GDADAMVAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKERDGFVLGDGAGMLV
LEEYEHAKARGAKIYAEIVGFGMSSDAYHMTSPPENGAGAALAMVNALRDAAIEPAQIGY
VNAHGTSTPAGDKAETQAVKSVFGDAASRVMVSSTKSMTGHLLGAAGAVESIFSILALRD
QAIPPTINLDNPDEGCDLDFVPHEARQVSDLEYALCNSFGFGGTNGSLIFKKI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaagcgtcgtgtagttgtgaccggactgggcatgttgtctcctgtcggcaatacc
gtagagtctacctggaaagctctccttgccggtcagagtggcatcagcctgatcgaccat
ttcgatactagcgcctatgcaacgaaatttgctggcttagtaaaggattttaactgtgat
gacattatctcgcgcaaagaacagcgcaagatggatgccttcattcaatatggaattgtc
gctggcgtacaggccatgcaggattctggccttgaagtgacggaagagaacgcaagccgt
attggcgccgctatcggctccggtatcggtggtctcggtctgatcgaagaaaaccacagt
tcgctggtaaaaggcggaccgcgtaagattagcccgttctttgtcccgtcgacgattgtt
aacatggtagcaggccatctgactatcatgtatggcctgcgtgggccaagcatctctatt
gcgactgcctgtacttcaggcgtgcataacatcggccatgccgcgcgtatcatcgcctat
ggcgatgcggacgcgatggtggcaggtggcgcagaaaaagccagtacgccgctgggtgta
ggcggttttggcgcagcgcgcgcgctgtcgacccgcaacgataacccacaggcggcgagc
cgtccgtgggataaagaacgcgatggttttgtactgggcgacggtgccggtatgttggtg
cttgaagagtacgaacatgcgaaagcgcgtggtgcgaaaatctatgctgaaatcgtcggc
tttggtatgagcagcgatgcttaccatatgacgtcgccgccggaaaatggcgcaggcgct
gcgctggcgatggttaacgcgttgcgtgatgccgcgattgagcctgctcagattggctac
gtcaacgcgcacggcacgtcgacgcctgccggcgacaaagctgagacgcaggcggttaag
tcagtctttggcgatgccgcaagccgagtgatggtgagctcgaccaaatcgatgaccggc
catctgttgggcgccgcaggcgcagtagagtctattttctctattctggcgttacgcgat
caggccattccgccaaccattaatctggataacccggatgaaggttgcgatctggacttc
gtgccgcatgaagcgcgccaggtcagcgatctggagtacgctctgtgtaactcctttggc
tttggcggaactaacggttccttgatttttaaaaagatctaa

DBGET integrated database retrieval system