KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_23050Help
Entry
BN855_23050       CDS       T02827                                 

Gene name
yeiR
Definition
(GenBank) putative cobalamin synthesis protein
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C
Motif
Other DBs
NCBI-ProteinID: CDF54483
LinkDB All DBs
Position
2266573..2267661
Genome map
AA seq 362 aa AA seqDB search
MAEARLRQLSTSLFHVYSPGLLKVVMLYQYSGADVTKTNLITGFLGSGKTTSILHLLAHK
DPAEKWAVLVNEFGEVGIDGALLADSGALLKEIPGGCMCCVNGLPMQVGLNTLLRQGKPD
RLLIEPTGLGHPKQILDLLTAPVYEPWIDLRATLCILDPRLLLDQQSVANENFRDQLASA
DIIIANKTDRATAQSDAALQQWWRQYGGDRQLIHAEHGQIDGKLLDLPRQNLAELPASAA
HSHTHASKKGLAALNLPAQQRWRRSLNSGQGHQACGWIFDADTVFDTIGLLEWARLAPVG
RVKGVMRIQEGLVRINRQGDDLHIETQSVAPPDSRVELISNTETDWNTLQTALLKLRLAT
HA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcacgacttcgtcaactcagcacttctctttttcacgtttattcgccagga
ttattaaaagttgttatgttgtatcaatattctggagctgacgtgaccaaaaccaatctt
attactggatttctcggtagcggaaaaaccacctctatccttcatttattagctcataaa
gatccggctgaaaagtgggccgtcctggttaatgaatttggtgaagtgggtattgacggc
gcgctgcttgccgacagcggcgcactgctaaaagagatccccggcggctgcatgtgctgc
gtcaatggattgcctatgcaggtggggctcaacacgctgctgcgccagggcaaacctgac
cggttgctgattgaaccaaccggactggggcacccaaaacagattctggatttattaact
gcgccggtttatgagccgtggattgatttacgcgccacgctctgcatccttgaccctcgt
ctgctactggaccaacagagtgtcgccaatgaaaatttccgcgatcagctcgcctcagcc
gatattatcatcgccaataagaccgatcgcgccacggcgcagagcgatgccgccctgcaa
cagtggtggcgacagtacggcggcgatcgtcaactgattcatgccgaacatggacagata
gacggtaagcttctggatttaccgcgacaaaatctggcggaactgccggccagcgccgcg
cattctcacactcatgccagtaaaaaaggactcgccgcgctaaatctgcccgcccagcag
cgctggcgacgcagcctcaatagcggacaaggtcatcaggcctgcggctggattttcgat
gccgataccgtgtttgacaccattggcctcctcgaatgggcgcgtctggcgccggtgggc
cgggtgaaaggcgttatgcgcatacaagaggggctggtacgcatcaatcgccagggcgat
gacctgcacatcgaaacacagagtgtcgcgccgccggacagccgggttgaacttatctca
aacacagaaaccgactggaatacgttacagacggccttgttgaagcttcgtttagcgacg
cacgcgtaa

DBGET integrated database retrieval system