KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_24740Help
Entry
BN855_24740       CDS       T02827                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb00071  Fatty acid degradation
senb00280  Valine, leucine and isoleucine degradation
senb00281  Geraniol degradation
senb00310  Lysine degradation
senb00362  Benzoate degradation
senb00380  Tryptophan metabolism
senb00410  beta-Alanine metabolism
senb00640  Propanoate metabolism
senb00650  Butanoate metabolism
senb00903  Limonene and pinene degradation
senb00930  Caprolactam degradation
senb01100  Metabolic pathways
senb01110  Biosynthesis of secondary metabolites
senb01120  Microbial metabolism in diverse environments
senb01130  Biosynthesis of antibiotics
senb01200  Carbon metabolism
senb01212  Fatty acid metabolism
Module
senb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:senb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BN855_24740 (fadJ)
   00650 Butanoate metabolism
    BN855_24740 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN855_24740 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN855_24740 (fadJ)
   00310 Lysine degradation
    BN855_24740 (fadJ)
   00380 Tryptophan metabolism
    BN855_24740 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN855_24740 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN855_24740 (fadJ)
   00281 Geraniol degradation
    BN855_24740 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN855_24740 (fadJ)
   00930 Caprolactam degradation
    BN855_24740 (fadJ)
Enzymes [BR:senb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BN855_24740 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN855_24740 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BN855_24740 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CDF54652
LinkDB All DBs
Position
complement(2443215..2445362)
Genome map
AA seq 715 aa AA seqDB search
MTTTSAFMLNVRLDNVAVVAIDVPGEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISA
KADNFIAGADINMIGHCQNAQEAETLARQGQQLMAEIQALPVPVIAAIHGACLGGGLEMA
LACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQAL
KAGLVDDVVPQTILLEAAVELAKKERLAQRTLPVRERILAGPLGRALLFRLVRKKTAQKT
QGNYPATERIIDVIETGLAQGSSSGYDAEARAFGELAMTPQSQALRAVFFASTEVKKDPG
SDAPPGPLNSVGILGGGLMGGGIAWVTACKGGLPVRIKDINTQGINHALKYSWDLLETKV
RRRHIKANERDKQLALISGSTDYRGFSHRDLVIEAVFEDLPLKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAANAARPEQVIGLHFFSPVEKMPLVEVIPHASTSAQTIATTVKLAKKQ
GKTPIVVSDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKGRKNGRGFYLYGEKGRKSKKQVDPA
IYKLIGVQGQSRLSAQQVAERCVMLMLNEAARCFDEKVIRSARDGDIGAVFGIGFPPFLG
GPFRYMDALGPGEMVATLQRLAALYGPRYAPCEQLVRMAERREHFWTNGETDQGN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacatcagcttttatgcttaacgtgcgtctggataatgtcgcagttgtcgct
attgatgtccctggagaaaaggtgaacaccctgaaagcggagtttgccgcgcaggtacgc
gccattctgaagcagatccgggaaaataaagcgttgcagggcgttgtttttatctcagcc
aaagcagataactttattgctggcgctgatatcaacatgataggtcactgccaaaacgcg
caggaagcggaaacgctggcgcgtcaggggcaacaactgatggcggagattcaggcgttg
cctgttccggttatcgctgccattcatggcgcctgtctggggggcggccttgaaatggcg
ctggcctgccatcggcgcatctgtaccgatgacgttaaaaccgttctcggactgccggag
gtacagttagggcttttaccgggatcgggcggaacgcagcgacttccacggctggtgggg
gtcagtaccgcgctggatatgatcctgacaggtaaacagcttcgcgccagacaggcgctt
aaagccgggctggttgatgatgtggtgccgcaaaccattttactggaagcggctgtcgag
ctggctaaaaaagaacgcctggcgcaacggacattgccggtccgtgaacgtatcctggcg
gggccgctggggcgcgcgctgttatttcgcctggtgcgtaaaaagacggcgcaaaaaacg
cagggtaattatccggcgacggagcggatcattgatgtgattgaaaccggactggcgcag
ggcagcagtagcggctatgacgcggaagcgcgcgctttcggcgagctggcgatgacgcct
caatcgcaggcgctgcgcgctgttttctttgccagtaccgaggtgaaaaaagatcccggt
agcgatgcgccgcccggcccgctgaacagcgtgggcatcttaggcggcgggttaatgggc
ggcggtatcgcctgggttacggcctgtaaaggcggtttgccagtacgaattaaggatata
aatactcaggggatcaatcatgctctgaaatacagctgggatctgcttgaaacaaaagta
cgccgccgccatatcaaagccaacgaacgcgataaacagttggcattgatatcaggttcg
accgattaccgtggtttcagtcatcgtgatctggtcattgaagcggtgtttgaagatctg
ccgttaaaacaacagatggtggcggaagtggaacaaaattgcgctgctcacaccattttt
gcctccaatacttcttccctgccgattggcgatattgcggcgaatgcggccagaccggaa
caggtgattggattgcacttttttagcccggtcgaaaaaatgccgctggttgaggttatt
cctcatgcgtctacttccgcgcagaccatcgccacgaccgttaagctggcgaaaaaacag
ggtaaaaccccgatagtcgtcagtgataaagccgggttttatgttaaccgaattcttgcg
ccgtatatcaatgaggcgattcggatgctgactgaaggcgaacgcgtcgaacatattgac
gccgccctggtaaaatttggttttccggtggggccaatccaacttttggatgaggtagga
atcgacacgggcactaaaattattcctgtgcttgaggcggcgtatggagaacgttttagc
gcgcctgcaaatgttgtcgcttcaattttgaatgacgatcgcaaaggtagaaaaaatggt
cgcggtttctatctttatggcgaaaaagggcgtaaaagcaaaaaacaggttgaccctgct
atttataagcttattggcgtgcaagggcagagtcgactgtctgcgcagcaggtggcagag
cgctgtgtcatgttaatgcttaacgaagcggcgcgctgtttcgacgaaaaagtgattcgc
agcgcgcgcgatggcgatattggcgccgtgtttggtatcggttttccgccgtttctcggt
ggcccgttccgctatatggatgctctcgggccgggtgaaatggtggcgacattacagcgc
ctggccgcactttacggtcctcgttacgcgccttgtgaacaattagtgcgcatggcggag
cgcagggagcatttctggacgaatggggaaactgaccagggaaattga

DBGET integrated database retrieval system