KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_26740
Entry
BN855_26740       CDS       T02827                                 

Gene name
gogB
Definition
(GenBank) Gifsy-1 prophage leucine-rich repeat protein
  KO
K23942  Gifsy-1 prophage leucine-rich repeat protein
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:senb00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    BN855_26740 (gogB)
SSDB
Motif
Pfam: FNIP LRR_4
Other DBs
NCBI-ProteinID: CDF54852
LinkDB
Position
2675734..2677200
AA seq 488 aa
MKIGFQPAILQYAYTSNEATSNLELLNKWRIESPDIEKEERNSIYDKIIEANHTGSLSIT
AHHVTSIPVFPDNLSELNLSSCYTLESIPNLPDGLKSLTISGNQTIKISYFPDSLESLSI
DMQAYEENYTFPVLPYGLKSFTACYGKFLPPLPPHLSSLSLQNFPEILCAELPYKLDKLD
LQNCPFLPLMKMLPEGLKELSIELIQTVPGTVIDDILPDKLKKLSINFCDNIKLPVKLPV
NLKSINLSSRTPIVWEIPTCNLPAHIDISTDGYVKLNPEFLTRSDITFSNKPAGDALSFQ
PGDVVYGLCKARDRVNTLVNSLYYFSKKDIIIQNTLTDAVWDRKNRAVFNKDEKIAERLN
DVQRGTFFREFLSQHKKYNITEDKYSDLSNEECWIKTSKAGLEFQTRLRERSVIFVIDNL
VDAISDIANKTGKHGNSITAHELRWVYRNRHDDLVKQNVKFFLNGEAISHEDVFSLVGWD
KYKPKNGV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaaaataggatttcaaccagccatattgcaatatgcatatacaagtaacgaggcgaca
tcaaaccttgagttattaaataaatggagaatagaatccccagatattgagaaggaggag
cgtaatagtatttacgacaaaataatagaagcaaatcataccgggagcttatcaattact
gctcatcatgttacctctattccggtatttcctgataatttatccgagttgaatttatct
tcatgctatacactggagtctattccaaatcttcctgatgggttaaaaagtttaactata
tctggaaatcagaccattaaaatttcatatttcccagatagcttagagtcactatctata
gatatgcaggcatatgaagaaaattatactttccccgtattaccttatggattaaagagt
tttactgcgtgctatggtaaatttttgcctccccttcctccgcatctatcttctttgtca
ttgcaaaatttccctgaaatattatgtgctgagttaccatataaattagataaattagac
ttacaaaattgccctttcttgccattaatgaaaatgttacctgaggggttaaaagaacta
agtattgaacttatacaaacagttcccggtactgttatagatgatattttgcctgataag
ctaaaaaaattaagtatcaacttttgtgataatattaaacttccagttaagcttcctgtt
aatttaaagtctatcaatttatcctcaaggacccctattgtatgggaaataccaacctgc
aatctgcctgcacatatagatattagtaccgatggttatgttaagcttaatcctgaattt
cttaccaggagtgatattacctttagtaacaaacctgcaggagatgcgttaagttttcag
cctggagatgtggtttatggtttatgtaaggcaagagatcgagtaaatactttagttaat
tcgttatattatttttcaaaaaaagatattattattcaaaatacattaacagatgcggtc
tgggacaggaagaatagagccgtgtttaataaagatgagaagatagcagaaagattgaat
gatgttcagagagggactttttttagagaatttttatctcaacataaaaaatacaatatt
accgaagataaatattcagacttatccaatgaggagtgctggataaaaacaagtaaagcc
ggtcttgaattccaaacacgattaagggaacggtcagttatttttgtcattgacaattta
gttgatgctataagtgatatcgcaaataaaacaggaaagcatggtaattctattacagca
catgagctaagatgggtatatcggaatcgacatgatgatctggtaaaacaaaatgttaaa
ttttttcttaatggtgaggctatttcacacgaagatgttttttcattagttggttgggat
aaatataagcctaaaaatggagtgtga

DBGET integrated database retrieval system