KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_28290Help
Entry
BN855_28290       CDS       T02827                                 

Definition
(GenBank) hypothetical protein
  KO
K11735  GABA permease
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Brite
KEGG Orthology (KO) [BR:senb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:senb02000]
    BN855_28290
Transporters [BR:senb02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BN855_28290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-ProteinID: CDF55008
LinkDB All DBs
Position
2823563..2824963
Genome map
AA seq 466 aa AA seqDB search
MGQLSESHALGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVM
IMRMLAEMAVATPDTGSFSTYADKAIGPWAGYTIGWLYWWFWVLVIPLEANIAAIILNSW
IPGIPVWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIALGATAISGFYPY
AEVSGISRLWDHGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPDKHIVRATNS
VIWRISIFYLCSIFVVVALIPWNMPGLKSVGSYRSVLELLHIPHAKFIMDCVILLSVTSC
LNSALYTASRMLYSLSRRGDAPAIMGKTNRSKTPWVAVLLSTGAAFLTVIVNYYAPAKVF
KFLIDSSGAIALLVYLVIAISQLRMRKILLAQGGEIKLKMWLYPWLTWLVIGFICFVLVV
MLFRPAQQLEVISTGLLGLGIIGTVPIMSRWKKLIRWQKAPLQNLR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggggcaattgtcagaatcacatgcattagggggcgggctgaaatcacgccacgtcacc
atgttatcgatcgccggcgttatcggcgccagcctgtttgtcggttccagcgtggcgatt
gcggaggccggccctgcggtactgctggcctatctgttcgcaggacttttagtcgtcatg
attatgcgaatgctggctgaaatggccgtcgccacaccggataccggttctttttccacc
tatgcggataaagcgatcggcccctgggccgggtataccatcggctggttatactggtgg
ttttgggtgctggttattccgctggaggccaatattgccgccattattctgaattcatgg
ataccgggtattccggtatggctattttcattagtgattacgcttgccttaaccggaagc
aatttattgagcgtcaaaaattacggcgagttcgaattctggctggcgctatgtaaagta
attgccattctggcgtttatcgcgctgggcgcgacagcgattagcggtttttatccgtat
gctgaggtaagcggtatctcccggctatgggatcacggtggttttatgcctaacggcttc
ggcgcggtgttaagcgccatgttgatcaccatgttctcttttatgggcgcggaaatcgtc
actattgctgccgcggaatccgatacgccggataaacatatcgtacgcgccaccaattct
gttatctggcgaatttccatcttttacctgtgttccatttttgtggtggtggcgctgatc
ccgtggaatatgccgggtctgaaaagcgtaggttcgtaccgttcggtactggagctgctt
catattccgcacgcaaaattcattatggactgcgtgattttattgtcggtgaccagttgt
ctgaactccgcattatataccgcctcccggatgctctattcccttagccgccgcggcgat
gcgcctgcgataatgggaaaaactaaccgtagcaaaacgccctgggtggcggttctcctc
tctaccggcgcggcgtttttaaccgttatcgtcaattattacgccccggcaaaagtgttt
aaatttcttatcgacagttctggcgccatcgcgctgctggtctatctggtgattgcgatt
tcgcaattgcgaatgcgtaaaattctgctggcgcagggcggagaaattaagctgaaaatg
tggctttatccgtggctcacctggctggttatcggctttatctgctttgtcctggtggtg
atgctatttcgaccggcacagcaactagaagtcatttcaacggggctgttagggctgggc
ataataggtactgtccccattatgtctcgctggaaaaaactgataaggtggcaaaaagcc
cccctgcaaaacctacgttag

DBGET integrated database retrieval system