KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_33420
Entry
BN855_33420       CDS       T02827                                 

Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb00052  Galactose metabolism
senb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BN855_33420
Enzymes [BR:senb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     BN855_33420
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 MTS ADH_zinc_N_2 2-Hacid_dh_C TrkA_N Methyltransf_31 Methyltransf_11 3HCDH_N PrmA Shikimate_DH UDPG_MGDP_dh_N Met_10 Pyr_redox_2 Sacchrp_dh_NADP CoA_binding Methyltransf_24 ELFV_dehydrog Pyr_redox FAD_binding_2 Fer4_4
Other DBs
NCBI-ProteinID: CDF55523
LinkDB
Position
3315910..3316953
AA seq 347 aa
MKSVVIHAEGDVRVEERPLPQLQAEDDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIEDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCA
RELGARSVTAIDINPQKLELAKALGATHTCNSREMTADDIQTALSDIQFDQLVLETAGTP
QTVSLAIDIAGPRAQLALVGTLHHDLTLTTRTFGLILRKELTLLGSWMNYSAPWPGEEWE
TAARLLAEKRLQLPPLIAHRGDAESFAEAVKALNGAPMQGKILLQLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtgcgcgttgaagaacgtcccttacca
caactgcaagccgaggacgatgtgttggtcaaggtcgttagctcagggctttgcgggtcg
gatatcccgcgtattttcgcgcagggcgcccattattatcctattacgttaggtcatgaa
ttcagcggctacgttgaatcctacggcacaggcgtaacggatatgcagcccggcgatgcc
gtcgcttgtgtcccgcttcttccctgctttcactgtccgcaatgcgaacgcggttacttt
tctttatgcaaacagtatcagtttgtaggatcgcgcagcgaaggcggtaatgcggaatat
gtggtggtcaaacgggccaatcttttccgcttgccgtctgatatgccgattgaagatggc
gcgtttatcgaaccgattaccgtgggcttacacgcctttcatctggcgcagggctgcgag
gggaaaaacgtaattatcgttggtgccgggacaattggcctgctggccttacagtgcgcg
cgggaactgggcgcgcgaagcgtaacggcgattgatatcaatccgcagaaactggaactg
gcgaaagcgctcggcgcaacgcatacctgtaatagccgggaaatgaccgccgacgacatc
cagaccgcgttgtccgacattcagtttgatcaactggttctcgaaacggcaggaactccc
cagaccgtctcgctggctatcgatatcgccgggccgcgcgcgcaactggcgctggtgggg
acgttacatcacgatctcaccctgacaacgcgtacattcgggttaattttgcgtaaagag
ctcacgctcctcggcagttggatgaactactccgcgccatggccaggagaagaatgggaa
accgcagcgcgcctgttagctgaaaaacgtcttcaactgccccctctcattgcccatcgc
ggcgatgcggaaagctttgcagaagcagtcaaagcgcttaatggcgcgcccatgcagggc
aaaatcttacttcaactttcctga

DBGET integrated database retrieval system