KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_3680Help
Entry
BN855_3680        CDS       T02827                                 

Gene name
ampH
Definition
(GenBank) penicillin-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Brite
KEGG Orthology (KO) [BR:senb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:senb01002]
    BN855_3680 (ampH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senb01011]
    BN855_3680 (ampH)
Enzymes [BR:senb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN855_3680 (ampH)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BN855_3680 (ampH)
Peptidases [BR:senb01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   BN855_3680 (ampH)
Peptidoglycan biosynthesis and degradation proteins [BR:senb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BN855_3680 (ampH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: CDF52544
LinkDB All DBs
Position
complement(393901..395031)
Genome map
AA seq 376 aa AA seqDB search
MLFAASLTSVQAAQPIADPVFASDIVDRYAEHIFYGSGATGMALVVIDGNQRVFRSFGDT
RPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGAHVPTYQGTP
ITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWNWLSTATLKVAPGSQAAYSNLAFD
LLADALATASGKPYTQLFEEKITRPLGMKDTTFTPSPDQCKRLMVAEKGASPCNNTLAAI
GSGGVYSTPGDMMRWMQQYLSSDFYHRSHQADRMQTLIYQRTQLKKIIGMDVPGKADALG
LGWVYMAPKDGRPGIIQKTGGGGGFITYMAMIPQYNIGAFVVVTRSPLTRFTNMSDGIND
LVTELSGNKPIAIPAS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttgcggcatcacttacttctgtccaggcggctcagccgattgccgatccggtt
tttgcctctgatatcgttgatcgttatgccgagcatatcttttatggtagcggtgccacg
ggcatggcgctggtggtgatcgacggcaatcaacgcgtgtttcgtagtttcggtgacacc
agaccgggcaataatgttcgtccacagcttgattcggtcattcgtatcgcttctctcacc
aagctcatgaccagtgaaatgttggtaaaattgctcgatcagggaacggtaaaattaaac
gatcctctcagcaaatatgcgcctcccggcgcgcatgtcccgacgtatcaaggcacgccg
attacgttggtcaacttagcgacccacaccagcgcgcttccgcgagaacagccaggcggc
gcggcgcatcgtccggtatttgtctggccaacccgcgaacaacgctggaactggctctcc
acagcaacgttaaaagtcgcgcccggttcacaggcggcctattccaatctggcgttcgac
ctgttagccgacgcgctggcgaccgcctccggcaaaccttatacgcaactgtttgaagaa
aagattacccgcccgctgggaatgaaagacaccacgtttaccccttctcccgatcagtgt
aagcgtctgatggtggcagaaaaaggcgcaagcccctgtaataatacgctggctgccatt
ggcagcggcggggtctattctacgccaggagatatgatgcgctggatgcaacagtatctg
tcttcagatttttatcaccgtagccatcaggccgatcgtatgcaaacgttgatttatcag
cgcacacagttaaagaaaatcatcgggatggacgtaccgggtaaagccgacgcgctcggt
ctgggctgggtctatatggcgccaaaagacggacgtcctggcattatccagaaaacagga
ggcggcggcggttttattacctatatggcgatgatcccgcaatataatattggcgctttt
gtggtggtaacccgttcccccctcactcgttttaccaatatgagcgacgggattaacgat
ttggttactgagctaagcggcaataaaccgattgctattcctgcatcctga

DBGET integrated database retrieval system