KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_39260Help
Entry
BN855_39260       CDS       T02827                                 

Gene name
dnaN
Definition
(GenBank) DNA polymerase III, beta subunit
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb03030  DNA replication
senb03430  Mismatch repair
senb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:senb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BN855_39260 (dnaN)
   03430 Mismatch repair
    BN855_39260 (dnaN)
   03440 Homologous recombination
    BN855_39260 (dnaN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:senb03032]
    BN855_39260 (dnaN)
   03400 DNA repair and recombination proteins [BR:senb03400]
    BN855_39260 (dnaN)
Enzymes [BR:senb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BN855_39260 (dnaN)
DNA replication proteins [BR:senb03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BN855_39260 (dnaN)
DNA repair and recombination proteins [BR:senb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     BN855_39260 (dnaN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3
Motif
Other DBs
NCBI-ProteinID: CDF56107
LinkDB All DBs
Position
complement(3907154..3908254)
Genome map
AA seq 366 aa AA seqDB search
MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVTLS
QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGDRMLVRSGRSRFSLSTLPAADFPNLD
DWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGSELRTVATDGHRLAVC
SMPLEASLPSHSVIVPRKGVIELMRMLDGGENPLRVQIGSNNIRAHVGDFIFTSKLVDGR
FPDYRRVLPKNPDKHLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQE
EAEEILDVSYGGTEMEIGFNVSYVLDVLNALKCETVRIMLTDSVSSVQIEDAASQSAAYV
VMPMRL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaccgttgaacgtgaacatttattaaaaccgcttcagcaggtcagcggcccg
ctgggcggtcgtcctacgctgccgattctcggtaacctgctcctccaggtagcggacggt
acgctttctctgaccggcaccgatcttgaaatggagatggtcgcgcgcgttacgctttct
cagccgcatgagccaggcgccactaccgtgccggcgcggaaattctttgatatctgccgc
ggcctgccggagggcgcggagattgccgttcagttggaaggcgatcggatgctggtgcgt
tctggtcgtagccgcttctcgctgtctacgctgcctgccgccgatttcccgaatcttgac
gactggcaaagcgaagttgaatttacgctgccgcaggccacgatgaagcgcctgattgaa
gcgacccagttttcgatggcccatcaggatgtgcgctactacttaaacggtatgctgttt
gaaacggaaggtagcgaactgcgcactgtcgcgaccgacggccaccgtctggcggtgtgc
tcaatgccgctggaagcgtctttacccagccattcggtgattgtgccgcgtaaaggcgtg
attgaactgatgcgtatgctcgacggtggcgaaaacccgctgcgcgtgcagatcggcagt
aataatatccgcgcgcacgtcggcgactttatctttacctcgaagctggtggatggtcgc
ttcccggattaccgtcgcgttctgccgaagaatccggataaacatctggaagcgggctgc
gatatcctcaagcaggcgtttgcccgcgcggcaatcctctcgaatgagaaattccgcggc
gtgcgtctgtacgtcagtgagaatcagctcaaaatcaccgccaataacccggaacaggaa
gaagcggaagagattctggacgtgagctacggcgggacggagatggaaatcggctttaac
gtcagttacgtgctggacgtgctcaatgcgctgaagtgcgaaaccgtgcgcattatgctg
acggattccgtatcgagcgtacagattgaggatgcggcgtcacagagtgctgcctacgtt
gttatgccaatgaggctgtag

DBGET integrated database retrieval system