KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_4860Help
Entry
BN855_4860        CDS       T02827                                 

Definition
(GenBank) chaperone protein HtpG
  KO
K04079  molecular chaperone HtpG
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Brite
KEGG Orthology (KO) [BR:senb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:senb01009]
    BN855_4860
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:senb03110]
    BN855_4860
   04131 Membrane trafficking [BR:senb04131]
    BN855_4860
   03051 Proteasome [BR:senb03051]
    BN855_4860
   03029 Mitochondrial biogenesis [BR:senb03029]
    BN855_4860
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senb04147]
    BN855_4860
Protein phosphatases and associated proteins [BR:senb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     BN855_4860
Chaperones and folding catalysts [BR:senb03110]
 Heat shock proteins
  HSP90
   BN855_4860
Membrane trafficking [BR:senb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    BN855_4860
Proteasome [BR:senb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    BN855_4860
Mitochondrial biogenesis [BR:senb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    BN855_4860
Exosome [BR:senb04147]
 Exosomal proteins
  Proteins found in most exosomes
   BN855_4860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c HP0268 PE Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: CDF52662
LinkDB All DBs
Position
507756..509654
Genome map
AA seq 632 aa AA seqDB search
MALLRSIHMKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALS
NPDLYEGDGELRVRVSFDKDKRTLTIADNGVGMNRDEVIDHLGTIAKSGTKSFLESMGSD
QAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGDKPENGVFWESAGEGEYTVADITKNDR
GTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQA
LWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTSLLYIPSQAPWDLWNRD
HKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLNVSREILQDSTVTRNLRSAL
TKRVLQMLEKLAKDDAEKYQTFWKQFGLVLKEGPAEDHANQEAIAKLLRFASTHTDSSAQ
TVSLEDYVSRMKEGQEKIYYITADSYAAAKNSPHLELLRKKGIEVLLLSDRIDEWMMNYL
TEFDGKAFQSVAKADESIEKLADEVDENAKEAEKALEPFVERVKTLLGDRVKEVRLTHRL
TDTPAIVTTDADEMSTQMAKLFAAAGQSVPEVKYIFELNPDHVLVKRTADTEDEAQFKEW
VELLLDQALFAERGTLEDPNQFIRRMNQLLVS
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggcattgttgaggtctatccacatgaaaggacaagaaacgcgtggttttcagtcagaa
gttaaacagcttctgcacctgatgatccattctctttattccaataaagaaatcttcctg
cgtgaactcatctctaacgcctcagatgcggcggacaagctgcgtttccgcgctctgtca
aacccggatctgtatgaaggagatggcgagctgcgtgtgcgcgtctctttcgataaagat
aagcgtacgttgaccattgccgataacggcgtggggatgaatcgtgatgaggtgattgac
cacttaggcaccattgccaagtccggcaccaaatctttcctcgaatcaatggggtccgat
caggcgaaagatagccagctcattggtcagtttggcgtaggcttctactccgcgtttatt
gtggccgataaagtgaccgtacgtacccgtgcggcaggcgacaagccggaaaatggcgtg
ttctgggaatcggcaggtgaaggcgaatacaccgttgccgatatcaccaaaaatgaccgt
ggtacggaaatcaccttacacctgcgtgaaggcgaagatgaattccttgatgactggcgc
gtacgctcgattatcagcaaatattccgatcacatcgcattgccggtagagattgaaaaa
cgggaagaaaaagacggcgaaaccgtgatttcctgggagaaaatcaacaaggcccaggcg
ttgtggacccgtaacaagtcggaaattaaagacgacgagtacaacgagttttacaagcac
atcgcgcatgatttcaccgatccgctgacctggagccacaaccgcgtggaaggtaagcag
gagtacaccagcctgctgtatatcccgtcgcaggcaccgtgggatctgtggaaccgcgat
cacaaacatggtctgaagctgtacgtacagcgcgtgttcattatggacgatgccgagcag
ttcatgccgaattatctgcgtttcgtgcgcggcctgattgattctaacgacctgccgttg
aacgtctcccgtgaaatcctgcaggacagcacggtaacgcgtaatctgcgtagcgctctg
accaaacgcgttctgcaaatgttggaaaaactggcgaaagacgacgcggaaaaataccaa
accttctggaaacagttcggtctggtgctgaaagaaggcccggcggaagatcacgccaac
caggaagcgatcgctaaactgttgcgctttgcctccacccataccgactcttccgcccag
accgtgtcgctggaagattacgtctcccggatgaaagaagggcaggaaaaaatctactac
atcaccgcagacagctatgcggcggcgaaaaatagcccgcacctggagctgctgcgtaag
aaaggcatcgaagtgctgctgctctccgatcgcatcgatgagtggatgatgaactacctg
accgagtttgacggtaaagcattccagtcggtcgctaaagccgatgagtccatcgaaaaa
ctggcggatgaagtcgacgaaaacgcgaaagaagcggaaaaggcgcttgagccgttcgtg
gagcgtgtcaaaaccctgctgggcgatcgcgtgaaagaggtgcgtctgacgcaccgttta
accgacacgccggcgattgtcaccaccgatgcggatgaaatgagcacccagatggcgaaa
ctgttcgccgcggccggtcagtccgtgccggaagtgaaatacatctttgagctcaatccg
gatcatgtgctggtcaaacgcactgccgataccgaggatgaagcgcagtttaaagagtgg
gtcgagctgctgctggatcaggcgctgttcgctgaacgcggtacgctagaagatccgaac
cagtttatccgccgtatgaaccagttgctggtgtcctga

DBGET integrated database retrieval system