KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_6010Help
Entry
BN855_6010        CDS       T02827                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F52a subunit; detoxification of hydroperoxides
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Brite
KEGG Orthology (KO) [BR:senb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN855_6010 (ahpF)
Enzymes [BR:senb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BN855_6010 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_3 Thi4 Glutaredoxin K_oxygenase AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: CDF52777
LinkDB All DBs
Structure
PDB: 

Position
627463..629028
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPV
RKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAATEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcagggcttaccttgagaaactgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcggaaatcaaggaactgctg
gctgaaatcgccgagctgtccgacaaagtcacgtttaaagaagacaatactctgccggtg
cgcaagccgtctttcctgattacgaatccaggttctcagcaggggccgcgctttgccggt
tctccgctgggccacgaatttacctcgctggttttggcgctgctgtggaccggcggtcat
ccgtcaaaagaagcgcagtcgctgctggagcagattcgcgatattgacggcgattttgaa
ttcgaaacttattattcactctcctgccataactgcccggacgtagtgcaggcgctgaac
ctgatggcggtgctgaacccgcgtattaaacatacggcaattgatggcggcaccttccag
aacgaaatcaccgaacgtaacgtgatgggtgttccggcggtatttgttaacggtaaagag
ttcggccagggacgtatgactctgaccgagattgtcgctaaagtggatactggcgcagaa
aaacgcgcggcggaagcgctgaacaaacgcgatgcgtatgacgtactgattgtcggctcc
ggcccggcgggcgcggcggcggcggtctactcggcgcgcaaaggcatccgtaccggtctg
atgggcgagcgcttcggcggtcaggtgctggataccgtggatatcgaaaactatatctcg
gtgccgaaaaccgaaggccaaaaactggcgggcgcgctgaaagcgcatgtcagcgattac
gacgttgacgttatcgacagccagagcgcaagtaaactggttccggccgcgacagaaggc
ggcctgcatcagattgaaacggcgtccggcgcagtattgaaagcgcgcagtatcatcatc
gccaccggcgcgaaatggcgcaatatgaatgtgccgggcgaggatcagtatcgcaccaaa
ggcgtcacctattgtccgcactgcgacggtccgttatttaaagggaagcgtgtggcggtc
atcggcggcggcaactccggcgttgaagcggctatcgatctggcaggtattgtagaacac
gttacgttgctggagttcgcgccggagatgaaggcggatcaggtgctacaggacaaagtg
cgtagcctgaaaaatgtcgatatcattttgaatgcgcaaacgacagaagtgaagggcgac
ggttcgaaagtggtggggctggagtatcgtgaccgtgtcagcggcgatattcatagcgtc
gcgctggcagggatttttgtgcagattggtctgttgccgaatacccactggctggaaggc
gcgcttgagcgtaaccgcatgggcgagatcattattgacgccaaatgtgaaaccagcgtt
aagggcgtcttcgctgcaggcgattgcaccaccgttccttacaaacagattatcatcgcc
acaggcgaaggggcgaaagcctcgttgagcgcctttgattatctgattcgtaccaaaatc
gcataa

DBGET integrated database retrieval system