KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_7090Help
Entry
BN855_7090        CDS       T02827                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb00020  Citrate cycle (TCA cycle)
senb00190  Oxidative phosphorylation
senb00650  Butanoate metabolism
senb01100  Metabolic pathways
senb01110  Biosynthesis of secondary metabolites
senb01120  Microbial metabolism in diverse environments
senb01130  Biosynthesis of antibiotics
senb01200  Carbon metabolism
Module
senb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
senb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
senb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:senb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN855_7090 (sdhA)
   00650 Butanoate metabolism
    BN855_7090 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN855_7090 (sdhA)
Enzymes [BR:senb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN855_7090 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BN855_7090 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: CDF52885
LinkDB All DBs
Position
742235..744001
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGVLRDASESDVEGSLERLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPERDDANWLCHTLYQPQTESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggccaaacctgtgcgctgctctcgaaagtcttc
ccgacccgttcccataccgtttccgcgcagggcggtatcaccgtggcgctcggcaatacc
catgaagataactgggaatggcacatgtacgacaccgtaaaagggtcggactacattggc
gaccaggatgccatcgaatatatgtgtaagaccggaccggaagcgattctggaactggag
cacatggggctaccgttctcccgtcttgatgatggacgtatctatcagcgcccgttcggc
ggccagtcgaaaaactttggcggcgagcaggcggcacgtaccgcggcggcggctgaccgt
accggtcacgccttgctacatacgctgtatcaacagaatttgaaaaaccacaccacgatt
ttctccgaatggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtgggatgt
accgcactgtgcatcgaaaccggtgaagtggtgtacttcaaagcccgcgcgacggtgctg
gcgaccggcggcgcaggccgtatctaccagtccaccaccaacgctcacatcaacaccggt
gacggtgtcggtatggcgctgcgtgccggtgtcccggtgcaggacatggaaatgtggcag
ttccacccgaccggcatcgccggggcgggcgtgctggtgacagaaggctgccgcggcgaa
ggcggttacctgctgaacaaacacggcgagcgctttatggagcgttatgcgccgaacgcc
aaagaccttgcgggtcgtgacgtggtggcgcgttccatcatgatcgaaatccgtgaaggc
cgcggctgcgacggtccgtgggggccgcacgctaaactgaaactggatcacctgggtaaa
gaggtgctggaatctcgcctgccgggtatcctggaactgtcccgtactttcgcccacgtt
gacccggtgaaagagccgattccggttatcccgacctgccactacatgatgggcggtatt
ccgactaaagtgaccggtcaggcgctgaccgtgaacgagcagggcgaagacgtggtcatt
ccggggctgtttgcggtaggcgaaatcgcctgtgtatcggttcacggcgccaaccgtctg
ggcggtaactcactgctggatctggtggtctttggccgcgcggcggggctgcatttacag
gaatccatcgccgagcagggcgtgctgcgcgacgccagcgagtctgacgttgaaggttct
ctggagcgcctgaatcgctggaacaataaccgcaatggcgaagatccggtggctattcgc
aaagcgttgcaggagtgtatgcagcataacttctccgtattccgtgaaggcgacgcgatg
gcgaaagggcttgagcagttgaaagtgatccgcgagcgtctgaaaaacgcccgtctggat
gacacgtccagcgagtttaatacccagcgtgtggagtgtctggagctggataacctgatg
gaaactgcctacgccactgccgtatcagccaacttccggacggaaagccgcggcgcgcat
agccgcttcgatttcccggagcgtgatgatgccaactggttgtgtcataccctgtatcag
ccgcaaacggaatccatgacgcgccgaagcgtcaatatggaaccgaaactgcgtccggcg
ttcccgccgaagattcgtacttattaa

DBGET integrated database retrieval system